EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03812 alignment
(3 sequences with 314 aa)


KDGT_ERWCA/1-314 MKIKQAIDKIPGGLMLVPLFLGALCNTFTPGAGKYLGSFSNGLITGTIPILAVWFFCMGASIEFKATGTMLRKSGVLVVTKIATAWVVALIAGTFLPGDGIQNGMLAGISVLALVAAMDMTNGGLYAALMNQYGSKEEAGAFVLMSLESGPLMTMVILGASGIATFEPQLFVGAVLPFLIGFALGNLDPDLRKLFGNSVQTLIPFFAFALGNTINLSVILQTGFAGIFLGLLVIVVTGIPLILADKFIGGGNGTAGVAASSSAGAAVATPLLIANMAPEFAPVAQQATALVATSVIVTSVLVPIITALWAKRFS
KDGT_ECOLI/1-314 MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMITGTVPILAVWFFCMGASIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVGFFAGLSTLALVAAMDMTNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGIASFEPHVFVGAVLPFLVGFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIPLIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFKPMAPAATSLVATAVIVTSILVPILTSIWSRKVK
KDGT_BACSU/1-314 MKIKATIERVPGGMMIIPLFLGAALNTFAPGTAEFFGGFTGALITGTLPILGVFIFCVGATIDFRSSGYIARKGITLLLGKIGFAALLGVIAAQFIPDDGIQSGFFAGLSVLAIVAVMNETNGGLYLALMNHMGRKEDAGAFAFISTESGPFMTMVTFGVTGLAAFPWETLAATVIPFLLGCILGNLDHDLRDLFSKVVPAIIPFFAFSLGNTLNFGMLIQSGLLGIFIGVSVVILSGSSLFLLDRFIARGDGVAGVAASSTAGAAVAVPYALAEANASFAPVAESATAIIATSVIVTSLLTPLATVWVDKKIK