EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03811 alignment
(4 sequences with 88 aa)


Q9AFV1_SHIFL/5-91 MTTVTVHCPRCNSDE-VYRHGRSCSRHERFRCRSCKRVFQLTYSYEARKLGVKEQIVEMAHNGAGGCYTARTLKIGINTVIRTLKSSR
INA2_SHIDY/1-87 MASVNIHCPRCQSAQ-VYRHGQNPKGHDRFRCRDCHRVFQLTYTYEARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTLKNSR
Q9AM88_9ENTR/1-88 MAKVDVKCPFCEQTESVKKHGQGKTGHQRYRCQLCRRTFQLDYAYRACQPGMKEQIVDLAMNNACIRYTARALHISINAVVRTLKNSR
INSA_ECOLI/1-88 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSG