EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03760 alignment
(8 sequences with 73 aa)


Q96272_ARATH/1-73 MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMHKRETRQHNAAMKEAA
PM1_SOYBN/8-80 GESIKETATNIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQAARQHNTAAKQSA
Q40928_PSEMZ/8-80 AAAAKEKMSNAAATTKEKLDKTKASAEEKMHKSTAHSKGEREIAHQEKEAKEAEAEMRKHSAKAENKIQREEE
Q8H683_ORYSA/1-73 MQAVKEKVKDKVSAVKAKGKVSKAKADEKKEVATARSHAERELAHERAKARVAAAKMELHQDKALHREEAIQH
Q96273_ARATH/1-70 MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTKKEKKLAQEREKSKEAQAKADLHQSKAEHAADA---
Q42167_ARATH/1-73 MQSAKQKISDMASTAKEKMVICQAKADEKAERAMARTKEEKEIAHQRRKAKEADANMDMHMAKAAHAEDKLMA
Q9ZTZ2_SOYBN/1-73 MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAGAKMELHEAKARHAAEKLSA
Q9XES9_SOYBN/1-73 MQSSKEKLKNMTSAAKEQVDIYKAKIDEKTEKATARTEEERVITHERAKAKEAEAKMELHEAKARHAAEKLST