EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03746 alignment
(16 sequences with 256 aa)


Y492_PSEAE/3-244 EVDLNSDMGEGFGPWTIGDgVDAAIMPLISSANIATGFHAGDPSSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQGLSLQHVKPHGALYMHLARDEVAARLFVETLQRLEPELLLYCMP---GSATWR-----.--IGRELGQPLVREFYADRDYDRSGSIVFTRRVAAL--DPQQVADKVL-RACREGKVRTVEGEDLDIAFDSVCIHSDTPGALELVASTRARLEGA
Y3576_VIBCH/5-246 TIQLNCDMGESFGVWTMGA.-DEEVMPWIDMANIACGFHASDPHVMSRTIDLALEHEVMIGAHPSYPDLQGFGRRSLAMNEQEVSEIILYQVGALKALCESKNGQLSYVKPHGALYNDMMSDPSIFRAVVDAVSCFNL--PLMVLASANNQDYLD-----.--IADRFDVPLLFEAFADRTYLANGKLTPRSQPNAVLSSEEAILNQVR-QIARYGKVTSSDGFVIPIEADTLCVHGDNPNAVSLIARIRAALDE-
Y2112_PSEAE/3-247 NLLLNCDIGESFGAWRMGL.-DAEVMPLIDCANIACGFHAGDPGTMRRTVALAVEHGVRIGAHPGYPDLVGFGRRSLACSAQEVEDLLLYQIGALDGLCRAQGTRVRYVKPHGALYQDMMRDPAILAAVLRALAAYDRTLPLMLMSTRDNTAARA-----.--LGEAHGIELWFEAFADRAYDGAGYLVSRSQPGAVHHDAETVLAQAL-LLARGAALRASDGSALALEAQTLCVHGDNPASLAAVRRIRDALEAA
Y4511_PSEAE/7-251 RILLNCDMGESFGAWRMGD.-DVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELE-----.--LADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQAL-AIARGEAFPDYDGNPLRLTADSLCVHGDNPQSLAVLRRLRAALDSL
Y2984_DEIRA/6-249 TTDLNADAGESFGHWPLGD.-DARLFPLLTSVNLALGFHAGDPVTLHSAVRLARQHGLGIGAHPGYPDLVGFGRRELALTPLEIQAATLYQIGALQAFLTVEGGTLQHVKAHGALYMRIHEDRAAGEAFCHAVQQLVPQAYLIVLAGAAGSDLAL-----.--TAAAHGLRVRREAFPERAYTGDGRLASRQLPGSSIHDPAEAARRAV-GMAQ-GWVQTLGGERLALEMDTLCIHGDNPQAVAIAGAIRAALAEN
Y441_STRCO/1-242 MIDLNADLGEGFGRWTLTD.-DDALLSVVTSANVACGFHAGDPSVMRRVCDLAAERGVRIGAQVSYRDLAGFGRRAMDVPSDELAAEVAYQIGALRVFAEAAGAPVAYVKPHGALYNRTVHDEGQARAVVAGVRLAGGALPVLGLP---GSRLLT-----.--AAAEAGLTGVPEAFADRAYTAEGSLVPRSEAGSVVTDEDAVVRRAL-AFAVEGSVEAVDGTAVAVAARSLCVHGDTPNAARIAARVREALETA
Y333_MYCLE/3-244 CIDLNADLGEGFGVWRLGD.-DEAMLRIVTSANVACGFHAGDPAGLLRVCRLAAERGVRIGAQVSYRDLVGFGRRFIDVTADDLLADVVYQIGALQAIAQTAGSAVSYVKPHGALYNTIVTNREQGAAVAAAIQLVDSTLPVLGLA---GSTFFD-----.--EAARIGLRTVAEAFADRTYRPDGQLISRREPGAVLHDPAVIAQRVV-TMVTTGKATAVDGTQLAVTVESICLHGDSPNAIQMATAVRDQLNAA
YBGL_ECOLI/2-238 KIDLNADLGEGCAS-----.-DAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLA---GSELIR-----.--AGKQYGLTTREEVFADRGYQADGSLVPRSQSGALIENEEQALAQTL-EMVQHGRVKSITGEWATVAAQTVCLHGDGEHALAFARRLRSAFAEK
Y030_NEIMA/3-239 QVDLNADLAEGCG-----S.-DEALLQLITSANIACAQHAGSIADIRAALAYAQQNGVRIGAHPGYPDRENFGRTEMNLSEADLRACLNYQLGALQALCRDQGLEMAYVKPHGAMYNQAAKNRALADTVARIVADFDPKLKLMALS---GSLLLE-----.--AGKAAGLGVISEVFADRRYMPDGTLVPRSRPDAQVDSDEEAIAQVL-QMVRDGQVKAVDGSLVAVQADSICLHGDGPHAVVFAEKIRQELLAA
Y1729_HAEIN/3-239 KIDLNADIAEGFP------.FDESLLQLLSSANVACGLHAGGAKEMQSAVKFAKENKVRIGAHPSFPDRENFGRTAMALSSQELIAHLRYQLGALKAICDGEGAVISYVKPHGALYNQAAKDEKIARLIAQTVYQFDPNLKLMGLA---GSLMLR-----.--IAEEEKLQTISEVFADRHYMPDGSLVPRSQPNAMVESDKEAIQQVL-QMVTKGQVNAIDGSLVPVKAESICLHGDNQHSLQFAKRIVEELEKN
Y1541_CAMJE/3-244 KVDLNSDLGESFGAYKMGM.-DEEILKFVSSVNVACGFHAGDPCVMDETLNLAKQNGVCIGAHPSYPDLLGFGRRNMQISFEEAKNYALYQLGALFGFAKAKGMKIQHFKAHGALYNMAAIDENLALALCEAVASFDENIIFLGLS---NSAMNE-----.--AAKKKGLRYANEVFADRAYNDDGTLVSRKLEGALIHDENLAIKRVI-KMIKESKVTSINGKEIDLKADSICVHGDNAKALEFVKKIKENLKKE
Y986_PYRHO/2-243 RVDLNSDLGESFGRYKLGL.-DEEVMKYITSANVACGWHAGDPLVMRKTVRLAKENDVQVGAHPGYPDLMGFGRRYMKLTPEEARNYILYQVGALYAFAKAEGLELQHVKPHGALYNAMVKEEDLARAVIEGILDFDKDLILVTLS---NSRVAD-----.--IAEEMGLKVAHEVFADRAYNPDGTLVPRGRPGAVIEDKEEIAERVI-SMVKDGGIRAINGEWVDLKVDTICVHGDNPKAVEITSYIRKVLEEE
Y1605_STAAM/2-243 RVDLNCDLGEAFGNYSFGG.-DHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVGAHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQLKINHVKPHGALYQMGAKDREIANVIAQAVYDFDPSLVLVGLA---NSYLIS-----.--EAKNVGLITASEVFADRRYEDDGQLVSRKESDAVITDTDEALKQVL-KMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREILMKE
Y1821_BACHD/3-244 RVDLNSDLGESFGAYTIGQ.-DDRVLEHVTSANIACGYHAGDHNVMARTVKLAADKGMGIGAHPGFPDLLGFGRRNIQTDHKDIYNFIVYQVAALNGFCQLHRVRMQHVKPHGALYNMAAKDRVIAEAIAEAIYDIDPSLILFGLS---GSELIK-----.--AGKKLGLTVANEVFADRTYQPDGTLTPRSEANALIKESERATEQVI-QMVKESKVIAVDGSHIPIEADTICVHGDSPTALSFIERLHAQLQVE
Y150_BORPE/4-245 AIDLNCDMGESYGAWRMGN.-DEAVLQFVTSANIACGFHGGDPSTMRQTVAAALAHGVALGAHPSLPDLAGFGRRAMQITPQEAYDLVVYQVGALAGVAASQGARLHHVKAHGALYNMAAKDAALARAICQAVRDVDSDLVLYGLA---GSALID-----.--AARAIGLRAAQEVFADRTYQADGQLTPRSQPDAMITDLDQAIAQVL-GMVRDGSVRTPDGQTVALQADTLCIHGDQPDALVFARGIRLALERD
LAMB_EMENI/7-254 KALINCDMGEAYGNWTCGP.-DLELLPLIDIANIACGFHAGDPLIMMETVRNCKAHNILVGAHPGLPDIQGFGRREMKLSPEELTAITIYQVGALQGFLDREGVRLNHVKPHGVLYGMMCRDYEVAKAVMLGIPKGSLCSAYQGPTWKRLPMIWELNFELsSMVMSSTTLTECLSLTARRSH---GTL--RMWRSMSGNSLRISLSRALMELSCRCRLKIMMCPFVVIPIRLAVLKSSRQRRKWWTNSIRS-MDFE