EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03723 alignment
(14 sequences with 266 aa)


SSP2_BOMMO/446-678 KPYTQDKLYFDGVKITDVKVDKLTTFFENFEFDASNSV--YFSKEEIKNN-HVHELRCAT-RLNHSPFNVNIEVDS--NVASDAVVKMLLAPKYDDNGIPLTLEDNWMKFFELDWFTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDEGKVP.---FDMSEEFCY----MPKRLMLPRGTEGGFPFQLFVFVYPFD-------------NKGKDLAPF.E-SFVLDNNLLASLWIAPLL--MHYSRFL-TCISR-IFSFTT
ARYB_MANSE/446-680 QPYSSEKLAFKGVKVVDVVVDKLVTFFEYYDFDASNSV--FWSKEEVKSS-YPHDFKIRQPRLNHKPFSVSIDIKS--EAAVDAVVKIFMAPKYDDNGFPLKLENNWNKFFELDWFTYKFVAGDNKIVRNSNDFLIFKDDSVPMTELYKLLEQNKVP.---HDMSEDYGY----LPKRLMLPRGTEGGFPFQFFVFVYPFN-------------ADSKDLAPF.E-AFIQDNKPLGYPFDRPVV--DAYFKQH-NMFFKDVFVYHD
ARYA_MANSE/449-682 QPYNQNDLHFVGVKISDVKVDKLATYFEYYDFDVSNSV--FVSKKDIKN--FPYGYKVRQPRLNHKPFSVSIGVKS--DVAVDAVFKIFLGPKYDSNGFPIPLAKNWNKFYELDWFVHKVMPGQNHIVRQSSDFLFFKEDSLPMSEIYKLLDEGKIP.---SDMSNSSDT----LPQRLMLPRGTKDGYPFQLFVFVYPYQ-------------AVPKEMEPF.K-SIVPDSKPFGYPFDRPVH--PEYFKQP-NMHFEDVHVYHE
SSP1_BOMMO/448-700 PKYTREQFSFPGVKVEKITTDELVTFVDEYDMDISNAM--YLDATEMQNKTSDMTFMARMRRLNHHPFQVSIDVMS--DKTVDAVVRIFLGPKYDCMGRLMSVNDKRLDMFELDSFMYKLVNGKNTIVRSSMDMQGFIPEYLSTRRVMESEMMPSG-.DGQTMVKDWWCKSRNGFPQRLMLPLGTIGGLEMQMYVIVSPVR--TGM-LLPTLDMTMMKDRCAC.RWSSCISTMPLGYPFDRPID--MASFFTS-NMKFADVMIYRK
JSB1_TRINI/445-698 PKYTREDFDFPGVKIEKFTTDKLTTFIDEYDMDITNAM--FLDDVEMKKKRSDMTMVARMARLNHHPFKVTVDVTS--DKTVDCVVRIFIGPKYDCLGRLMSVNDKRMDMIEMDTFLYKLETGKNTIVRNSLEMHGVIEQRPWTRRILNNMIGTVGTiSKTVDVESWWYK-RHRLPHRMLLPLGRRGGMPMQMFVIVTPVK--TNL-LLPNLDMNIMKERKTC.AGASVSTRCRSGFPFDRKID--MTHFFTR-NMKFTDVMIFRK
JSB2_TRINI/446-699 PSYTKEDLYFPGVKIDNVVVDKLVTYFDDYLMDMTNAV--YLTEDEIKKTKSDMVFMVRKRRLNHQPFKVTLDILS--DKSVDCVVRVFLGPKKDNLNRLIDINRNRLNFVELDTFLYKLNTGKNTIVRNSYDMHNLVKDRMMTRDFMKKVESITD-.MRDLMIKDLRNY-HTGFPTRLLLPKGFVGGMHMMLYVIVTPLRLVDNV-DINILDINRKDLMRDF.RSTVLLDKMPLGFPFDRRID--VGNFFTP-NMKFVEVTIFHK
ARY1_CALVI/485-736 KPYTHEELLFPGVTIKDVKVSELVTYFDLVDFDVTNLMNDEMTFVDGQFV-WDKTLLARQMRLNHKPFDFDFVIES--DKSHKVVIRTFLGPKYDEFGRVITLTENRQNFMEIDSFIYTLKSGVNDFKRLSKDFYWTVEDRTTYNELYKYVMLALQG.--KYDFPLDISEPHCGFPDRLVLPHGWYKGMPMQFFFYIAPYTASYGP-----FSTYDSTYACGIgSGVRHIDEMPFGYPFDREID--EYEFFVP-NMYFKDVKIYHQ
HCYE_EURCA/374-620 PHYTPEDLTCPGVHVVNVTVNAKVPNVVTTFMKEA-----ELELSYGIDFGSDHSVKVLYRHLDHEPFTYNISVENSSGGAKDVTMRIFLGPKYDELGNRLQPEQQRTLNIELDKFKATLDPGKNVVTRDHRNSTVTVEQSVPVKKLREEGGVAG--.----------EYCSCGWPEHMLIPKGNHRGMDFELFVIVTDYAQDAVNGHGENAECVDAVSYCGA.KDQKYPDKKPMGFPFDRVIEGLTFEEFLTVSMSCTDVRIKYT
HCY6_ANDAU/376-625 HPYTKEELSFPGVEVVGVSINSKTANVITTLIKES-----LLELSHGINFGTDQSVKVKYHHLDHEPFTYNIVVENNSGAEKHSTVRIFLAPKYDELNNKLEPDEQRRLFIELDKFFYTLTPGKNTIVRNHQDSSVTISKVRTFDQLGAGEGVSED-.--------STEYCSCGWPEHMLIPRGSHKGMEFELFVMLTDHDEDTVAGLSENAVCSDAVSYCGA.RDDRYPDKKAMGFPFDRKIEARTAAEFLTPNMGLTDIKIKFH
HCYD_EURCA/376-622 PSYTHQQLDFPGVRISRVTVRSKVPNLIHTYSKDS-----LLELSHGINL-KGH-IQVKYEHLDHEPYNYEIEVDNRTGEARETCVRIFLAPKYDELGNRLILEEQRRLYIELDKFHRRLEPGKNVLVRASGDSSVTLSKVPTFEELESGNANVNP-.--------N-EYCSCGWPEHMLVPRGKERGMDFYLFVMLTDYEEDKVQGAGEQTICSDAVSYCGA.KDQKYPDKKAMGYPFDRPIQVRTPSQFKTPNMAFQEIIIQYE
HCYA_EURCA/380-629 PVYSKDNLDFPQVTITDVKVKAKIPNVVHTFIRED-----ELELSHCLHFAKPGSVRARYHHLDHESFSYIISAQNNSNADKQATVRIFLAPTYDELGNDISLDEQRRLYIEMDKFYHTLRPGKNTIVRSSTDSSVTLSSVHTFKELLRGEDLVEG-.--------QTEFCSCGWPQHLLVPKGNEKGMQFDLFVMLTDASVDRVQSGDGTPLCADALSYCGV.LDQKYPDKRAMGYPFDRKITADTHEEFLTGNMNISHVTVRFQ
HCY2_LIMPO/379-627 KPYDHDVLNFPDIQVQDVTLHARVDNVVHFTMREQ-----ELELKHGINPGNARSIKARYYHLDHEPFSYAVNVQNNSASDKHATVRIFLAPKYDELGNEIKADELRRTAIELDKFKTDLHPGKNTVVRHSLDSSVTLSHQPTFEDLLHGVGLNEH-.--------KSEYCSCGWPSHLLVPKGNIKGMEYHLFVMLTDWDKDKVD-GSESVACVDAVSYCGA.RDHKYPDKKPMGFPFDRPIHTEHISDFLTNNMFIKDIKIKFH
HCYC_PANIN/405-655 TPYTRDELEFNGVSIDSIAIEGTLETFFENFEYSL-----LNAVDDTVDI-ADVEILTYIERLNHKKFSFLILVTNNNNTEVLATVRIFAWPLRDNNGIEYSFNEGRWRALELDRFWVKVKHGHHQITRQSTESSVTVPDVPSLQTLIDRADAAISS.--GCALHLEDYESALGLPNRFLLPKGQAQGMEFNLVVAVTDGRTDAAL-DDLHENTKFIHYGY--.-DRQYPDKRPHGYPLDRRVDDERIFEALP-NFKQRTVKLYSH
HCYA_PANIN/399-652 PPYTHDNLEFSGMVVNGVAIDGELITFFDEFQYSL-----INAVDSGENI-EDVEINARVHRLNHKEFTYKITMSNNNDGERLATFRIFLCPIEDNNGITLTLDEARWFCIELDKFFQKVPKGPETIERSSKDSSVTVPDMPSFQSLKEQADNAVNG.--GHDLDLSAYERSCGIPDRMLLPKSKPEGMEFNLYVAVTDGDKDTEG-HNGGHDYGGTHAQCGV.HGEAYPDNRPLGYPLERRIPDERVIDGVS-NIKHVVVKIVHH