EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03719 alignment
(11 sequences with 75 aa)


RT05_YEAST/220-293 IDFRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGKVYK-SRNDMNIAKGTIEAFTKAQKTLDEVALGR
RS5_MYCCA/119-192 SLGTFGAGKILIKPAKVGTGIIAGGPARSVIELSGISDVYAKSLG-SNNAINMIRATFEGLSSMQTLKRVQELRY
RS5_MICLU/82-155 VQGEDAAGVVLLRPASPGTAVIAGGPVRAVLECAGIHDVLSKSMG-SVNAINIVRGTVEGLKKLKSPQAVAARRG
RS5_ECOLI/84-157 VKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYG-STNPINVVRATIDGLENMNSPEMVAAKRG
RR5_CYAPA/92-165 IDGIGGAARVIMRPSAEGTGVIAGGAVRTVLELAGVRNILAKQLG-SNNPLNNARAAMNALSRLKTFSQFAKDRG
RS5_CHLTR/88-161 VLVNHDGAELLLKPAKPGTGIVAGSRIRLILEMAGVKDIVAKSLG-SNNPMNQVKAAFKALLTLSCKDDIMKRRA
RS5_METVA/141-215 AKGTCGSVKVELLPAPRGVGLVAGNVAKAVLGLAGVKDAWTTTYGDTRTTYNFAEATFDALNNLNFVRCLPEQKA
RS5_HALMA/132-205 TEGKAGSVEVELQPAPRGLGLAGGETVRKVLELAGIEDIWTRSSGNTRTTVNFAKATFNALQNTAEAR-VPERTF
RS2_YEAST/157-230 TTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFL-TPNLWA
RS2_DICDI/171-244 VTGKCGSVAVRLVPAPRGTGIVAARVPKKLLQYAGVDDVYTSSRGKTRTMGNFVMATFFAITKTFAYL-TPDLWR
RS2_CRIGR/124-197 VTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYL-TPDLWK