EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03712 alignment
(13 sequences with 175 aa)


Q9XTQ6_CAEEL/334-500 KYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKN-LPEEGINIFASQLHAHLTGRKLFTSQYR.....SGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYPASDV--EVCKSAISNSTLRAYFSERHGMDGKR
Q24549_DROME/400-565 SMTA-VMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFR.....GEQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKD-DKTALGGFSISDEMCVNYIHYYPATKL--EVCKSSVSEETLENYFIYMKRTEHQH
DOPO_RAT/362-529 PNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFASQLHTHLTGRKVITVLAR.....DGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRTMATVGGFGILEEMCVNYVHYYPKTEL--ELCKSAVDDGFLQKYFHIVNRFGNEE
DOPO_HUMAN/345-512 RFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVR.....DGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQL--ELCKTAVDAGFLQKYFHLINRFNNED
O01404_DROME/199-356 KKLAG----TLLLGTDGQIPAMKT-EHLETACEVNEQKV------LHPFAYRVHTHGLGKVVSGYRVRtnsdgEQEWLQLGKRDPLTP---QMFYNTSNTDPIIEGDKIAVRCTMQSTR-HRTTKIGPTNEDEMCNFYLMYYVDHGE--TLNMKFCFSQGAPYYFWSNPDSGLHN
O44398_CALPA/192-346 HHLA--AILVLTNRERAAIPPQKEAFNLDMGCQYTGKTI------IHPFAFRVHAHSLGSVTTGYRIR.....NKKWELIGKGDPQRP---QAFYAIDKNMDIRSGDILAGQCTYNTMKKQKTTYIGATMKDEMCNFYMMYYYDS----STPGSAAPGDYCREHFVSPADSIVLL
AMD_BOVIN/194-347 PLIA---GMYLMMSVDTVIPPGGKVVNSDISCHYK-KYP------MHVFAYRVHTHHLGKVVSGYRVR.....NGQWTLIGRQSPQLP---QAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTHIGGTSSDEMCNLYIMYYMEAKH--AVSFMTCTQNVAPDIF-RTIPPEANI
AMD1_XENLA/195-348 PQIA---GIYLSMSVDTVIPPGEEAVNSDIACLYN-RPT------IHPFAYRVHTHQLGQVVSGFRVR.....HGKWSLIGRQSPQLP---QAFYPVEHPVEISPGDIIATRCLFTGKGRTSATYIGGTSNDEMCNLYIMYYMDAAH--ATSYMTCVQTGEPKLF-QNIPEIANV
Q9Y1M4_LYMST/1160-1313 PFVA---GVYFMAS-MFEIPSGFPAYPVDVSCMFDKQKS------IFPFAYRTHAHALGRVITGYQY-.....NGSYHEIGKGNPQWP---QAFYPVKDKIEVKPGEYLAARCTYDSTSMTSSVKVGSTGNDEMCNFYIMFYTDSSV--LDPYGKCLGNLAPELTGDNFPKDVSV
Q9Y1M4_LYMST/829-983 KFVA---GIYFLMSPMFNIPPGETSYPIDVSCKFGAEKS------IVPFAYRTHAHGLGRVITGYQH-.....NGSYHEIGKGNPQWP---QAFYPVKDLIEVKPGDALAARCTYDSTTMAHAVSVGSTGNDEMCNFYIMFYTDSSV--INPYGQCAGNHLPDVTGRNFPPDVSV
Q9Y1M5_LYMST/493-647 KFVA---GIFLLMSTSFSIPEGNSSYPVDISCKFDQEKS------IFPFAYRTHAHGLGRVITGYQK-.....NETYHQIGKGNPQWP---QAFYPVKDVIEVKPGDYLAARCTYDSTSMSHPVSVGATGNDEMCNFYIMFYTDSSV--LEPYGDCSYDEYPDLTGQNFPKDVSM
Q9Y1M4_LYMST/162-316 QYVA---GIYILMAGYFSIPSGKKSYPVDVSCSFNEEKS------IFPFAYRTHAHGLGRVITGYQF-.....NGSHHEIGKGNPQWP---QAFYSTQNKIEVKKGDKLAARCTYDSTSMTHPVSVGSTGSDEMCNFYIMFYTDSSV--VNPYGQCVGDFEPLVTGQNFPKDVSD
P83388_CAEEL/167-321 MNLA---A-VMLFVSGTPIPPQLPAFQNNITCMFESSTP------IHPFAFRTHTHAMGRLVSAFFKH.....DGHWTKIGKRNPQWP---QLFEGIPSKLMIGSGDQMSASCRFDSMDKNRTVNMGAMGVDEMCNFYMMFHYDAKLDNPYPQGAICAKDYPSKMIDYPKDGF--