EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03711 alignment
(9 sequences with 138 aa)


Q9Z4R7_EIKCO/568-702 LPRVFNESPSFYQEMRIQELAQGIHSLICKHNLPELMFSAF--EVLP-TMVMNPHKAFQLELKGQIEDCYLEDMVGKINANMILPYPPGVPLVMPGEMITEESKPILEFLMMLCEIGAHFPGFETDIHGAYRQEDGRY
DCLY_ECOLI/570-704 LPSLYREDPEFYENMRIQELAQNIHKLIVHHNLPDLMYRAF--EVLP-TMVMTPYAAFQKELHGMTEEVYLDEMVGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIHGAYRQADGRY
DCLZ_ECOLI/570-704 LPDLYAEDPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAF--DTLP-EMIMTPHQAWQRQIKGEVETIALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIHGAKQDEDGVY
DCOS_ECOLI/576-709 LPSIYKQHEERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFP-RVSMNPQEANYAYLRGEVELVRLPDAEGRIAAEGALPYPPGVLCVVPGEIW---GGAVLRYFSALEEGINLLPGFAPELQGVYIEEHDGR
DCOR_ECOLI/568-701 LPSVYNKYPVRYRDYTLRQLCQEMHDLYVSFDVKDLQKAMFRQQSFP-SVVMNPQDAHSAYIRGDVELVRIRDAEGRIAAEGALPYPPGVLCVVPGEVW---GGAVQRYFLALEEGVNLLPGFSPELQGVYSETDADG
DCOR_HAEIN/575-708 LPTVYKNNEDRYKGYTIRQLCQEMHDLYVSRNVKQLQKDLFRKATLP-EYVLNPHDANIELIRNKVELVPLTDIVGRVAAEGALPYPPGVLCVVPGEKW---STTAHQYFLALEEGINTLPGFAPEIQGVYLQKDPDG
DCOR_LACS3/576-709 LPSIYAANEERYNGYTIRELCQELHDFYKNNNTFTYQKRLFLREFFP-EQGMLPYEARQEFIRNHNKLVPLNKIEGEIALEGALPYPPGVFCVAPGEKW---SETAVKYFTILQDGINNFPGFAPEIQGVYFKQEGDK
YAAO_BACSU/385-478 VSAEWGVQPV---------------------------------TVLPY-----PKKVLHSF---KKEYVSFEEAAGRLNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMK---THVQGNMKIKEKQLLVYIEEE
ADIA_ECOLI/615-748 MPELVEQYPDTYANMGIHDLGDTMFAWLKENNPGARLNEAY--SGLP-VAEVTPREAYNAIVDNNVELVSIENLPGRIAANSVIPYPPGIPMLLSGENFGDKNSPQVSYLRSLQSWDHHFPGFEHETEGTEI-IDGIY