EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03708 alignment
(3 sequences with 262 aa)


ENV_RSVSA/157-402 LNVSM-WDEPHELQLLGSQSLPNITNIAQISGITGGCVGFRPQ--GVPWYLG-WSRQEATRFLLRHP-------SFSKSTEPFTVVTADRHNLFMGSEYCGAYGY-RFWNMYNCSQVG-RQYRCGNARSPrPGLPEIQCTRRGGKWVNQSQEINESEPFSFTVNCTASSLGNASG-CCGKAGTILP-GKWVDSTQGSFTKPKALPPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPKHTDILKVLVNSSRTGIRR-KRS
O92955_9RETR/156-409 LNVSL-LDEPSELQLLGSQSLPNITNITRIPSVAGGCIGFTPYDSPAGVY-G-WDRREVTHILLTDPGNNPFFDKASNSSKPFTVVTADRHNLFMGSEYCGAYGY-RFWEMYNCSQMRQNWSICQDVW-G.RGPPENWCTSTGGTWVNQSKEFNETEPFSFTVNCTGSNLGNVSG-CCGEPITILPPEAWVDSTQGSFTKPKALPPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPNHTDILKILANSSRTGIRR-KRS
O73908_CHICK/16-248 LNTTLPWD-PQELDILGSQMIKNGTTRTCVT-FGSVCYKENNRSRVCHNFDGNFNGTGGAEAELRD------FIEKWKSDDLLIRPYVNQSWTMVSPINVESFSISRRYCGFTSNETH---YYRGDLS--.-----NWCGSKRGKWS--AGYRNGTKCSSNTTGCGGNCTTEWNYYAYGFTFGKQPEVLWNNGTA------KALPPGIFLICGDRAWQGIPRNALGGPCYLGQLTMLSPNFTTWITYGPN--ITGHRRSRRS