EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03686 alignment
(3 sequences with 135 aa)


Y209_PYRHO/1-131 MIEVAEIIAREIRRG-KIVEIGVGFYLEVAKRLRESG-IDILVVDINEKAINYARKQGIKGVVDDIFNPTLGIYKDAKAIYSIRPAPEMMKPLLDLARKLKIPLYIVPLTGDRT--PNGMKLINYKGIPIYKWEP
Y194_PYRAB/1-131 MIEVAEFIAREVKKG-KVIEVGIGFYTRIAKRLKELG-FDVLAIDINKDAVVNAKNSGLNAEVDDIFNPNISLYMGAKAIYSIRPTPEMMNYILKISKAVKVPAYIVPLTGDPV--PQGMKLITYRGIPIYKWEP
YA00_METTH/2-128 WNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPS--------HGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIA