EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03676 alignment
(4 sequences with 413 aa)


U183_CAEEL/31-420 KSSQFEFVLGMPINQCIAMIQQHPRMLTKVELKYSKKDPFYQDIIIYIGSTGIRLYFDGLSQLIKLIEVDNLSMITLTYNDTIFSDPNNMATLDRVNEFFGSTHPGSYDDKHNIYVQSWPGLSFCFPYGGENSNLEVRPGFGGNLRSLKYDANSQPKLTKMSIYRGPNPSEPESVDTPFSCYCGQNRTRKVEAIWENGN-IVGIDIQFDTQN-GRIVDGEYDVSTYTRQIYFGDSVSDVQSILGAPTKVFYKSDDKMKIHR-GLHKETLYGPPNFFFNYFVMGLDILFDFVSKRVVKFVLHTNAPGHCDFGMYSRCNFSIFLNDKQYEIR---------------TDSKFDEFSHAFMNDSNP-PRPVVLARQEQ----QPFGSTFCYGIKQIIVERTENGFLTSVTIYDGAK
U183_HUMAN/13-409 GNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGAT--VKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTG-PAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADG-----------QTETCTTYSKWDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYG--P
U183_DROME/13-417 GCDAWEFVLGMHFSQAIAIIQSQVGIIKGVQVLYSDTTPLGVDIIINLPQDGVRLIFDPVSQRLKTIEVFNMKLVKLRYFGVYFNSPEVLPSIEQIEHSFGATHPGVYDAAKQLFALHFRGLSFYFPVDS-----KLHSGYAHGLSSLVFLNGASPVVSKMSLYAGSNVLENRVPSLPLSCYHRQMYLESATVLRTAFGHTKGLKLKLFTEGSGRAL--EPRRQCFTRELLFGDSCEDVATSLGAPNRIFFKSEDKMKIHSSSVNRQAQSKRSDIFFNYFTLGIDVLFDARTQTCKKFILHTNYPGHFNFNMYHRCEFQFLLQADHPSMSDSGHDLVTPTKQEHVNITAYTKWDAISSALATS-ERPVVLHRASSTNTANPFGSTFCYGYQDLIFEVMPNSHIASVTLYNTAP
U183_ARATH/35-412 GVGIGPFSIGMPICEAFAQIEQQPNIYDVVHVKYYDEDPLKLDVVISFPDHGFHLRFDPWSQRLRLVEIFDVKRLQMRYATSMIGGPSTLATFVAVYALFGPTFPGIYDKERGIYSLFYPGLSFEFPIPNQYTDCCHD---GEAALPLEFPDGTTPVTCRVSIYDNSS--DKKVGVGKLMDRASVPPLPPGSLYMEEVHVKPGKELYF---------------TVGGQHMPFGASPQDVWTELGRPCGIHPKQVDQMVIHSASDPRPKTTICGDYFYNYFTRGLDILFDGETHKVKKFVLHTNYPGHADFNSYIKCNFVISAGADAAEANR-----------SGNKITPSTNWDQVKEILGECGPAAIQTQGSTS----NPFGSTYVYGYQNVAFEVMHFCNNPRFSNFDPCY