EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03668 alignment
(3 sequences with 287 aa)


YHBJ_ECOLI/1-282 MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARTLA---DREISAAVSIDVRNMPESPEIFEQAMSNLPD-AFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQ-SRHRTLEKR
YVCJ_BACSU/9-292 IQLVIITGMSGAGKTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKESNSKMSKVALVMDLRGREFFDRLIEALDEMAENPWITPRILFLDAKDSILVTRYKETRRSHPLAATGLPLEG-IALERELLEELKGRSQIIYDTSDMKPRDLREKIVKHFATNQGETFTVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIESMRPLTGKDKEVSSYVMKWNETQKFNEKLIDLLSFMLPSYKREGKSQVVIAIGCTGGQHRSVTLAENLADYFKKDYYTHV--THRDIEKR
Y1456_MYCBO/17-301 IDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATR-AITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEG-IAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDGGATTSVTVESFGFKYGLPMDADMVMDVRFLPNPHWVDELRPLTGQHPAVRDYVLHRPGAAEFLESYHRLLSLVVDGYRREGKRYMTIAIGCTGGKHRSVAIAEALMGLLRSDQQLSVRALHRDLGRE