EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03650 alignment
(6 sequences with 128 aa)


YGI0_YEAST/11-129 RSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFL--KYTYFTTDEEKK---ALDKEWK----EKEKTGK
YNFD_CAEEL/11-135 YFKQHSTAEWKHYF--LSTHFWGPVANWGLPLAALGDLKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNLLLFACHFANFSAQGAQLGRFVNHNYLHYVEDPVHHK-LMMKKEVLEHEHDAERVSL
YAI9_SCHPO/1-118 MFRAGFKRFWNHPAGPKTVHFWAPAMKWTLVLSGIGDYARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYFNATVNFFLAIVGAVQVSRIL--VYQRQQKRITAQ--SEQRTEL------ARSLAA
YHW2_YEAST/5-126 SVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIA--NYRIRNGDSISQLCSYILSGAD----ESKKEIT
YG56_YEAST/5-130 AFNFAFRRFWNSETGPKTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIA--NFRIRNGDSFKQVIHYIIKGETPAAVAAKQTAS
YXX3_CAEEL/22-127 VLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLADLARPADKLSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIA--HYRYQNPDWETK--------------------E