EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03634 alignment
(17 sequences with 269 aa)


Q9CA43_ARATH/74-283 VDGSTSQEVQWRRTVKKRDRHSKICTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKTSIKQLKERVAASEGGGKDEHLQV-----------------.--.--------------------------DEKEKDETLKLRVSKRRTKTMESSFKTKESRERARKRARERTMAKMKMRLFETSETISDP------------HQETREIKITNGVQLLEKENKEQEWSNTNDVHMVEYQMDSVSIIEKFLGLTSDSSSS
Q9FUE7_POPDE/106-351 DTSKQ----PIRQRRTGKDRHSKIHTAQGPRDRRMRLSLQISKKFFDLQDMLGFDKASKTIEWLFTKSKAGIKELTDS--VPGGRRRCSICADGKSVC------------.--.-STPESEVVSGIKLTPETNGDKRGTKAKNDSLVSNPKEKRSKKVHKPVFNLVDRDSREKARARARERTRERMKNQGIDTSSDRSSQANPNKLEKFESSSPLEYGENLAPVNQEMSSPLKVGDVKESSNHDLLPHQMDYVSITGNFFWITNSPRSS
Q9XGR9_LINVU/79-321 DPANMAETFQTKQSTVKKDRHSKIYTAQGPRDRRVRLSIGIARKFFDLQEMLGFDKPSKTLDWLLTKSKTAIKELVQSKSTKSNSS------------------------.-NsHSDDDCDDEVVSAEGDSENAADSKGKSVLIKGNYKCKEAASAMDSQQAALNLVKESRAKARARARERTKEKMCIKQQLNEARNNNKGGDWINNPFNNVIQSNRNHQQFESREAAFVHHPVFGFHQQNYSNASASSHENWDQSNQLCAILNQHKFI
Q9FYG7_ARATH/77-314 EVSK------EIKKVVKKDRHSKIQTAQGIRDRRVRLSIGIARQFFDLQDMLGFDKASKTLDWLLKKSRKAIKEVVQAKNLNNDDEDFGNIGG-----------------.--.-DVEQEEEKEEDDNGDKSFVYGLSPGYGEEEVVCEATKAGIRKKKSELRNISSKGLGAKARGKAKERTKEMMAYDNPETASDITQS---EIMDPFKRSIVFNEGEDMTHLFYKEPIEEFDNQESILTNMTLPTKMGQSYNQNNGILMLVDQSSSS
Q9LII4_ARATH/132-395 ISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIATTLSHHGCFSSGDESHIRPVLGSMDTSSDLCELA.--.-SMWTVDDRGSNTNTTDKLSYTLETRGNKVDGRSMRGKRKRPEPRTPILKKLSKEERAKARERAKGRTMEKMMMKMKGRSQLVKVVEEDAHDHGEIIKNNNRSQVNRSSFEMTHCEDKIEELCKNDRFAVCNEFIMNKKDHISNESYDLVNYKPN
Q9LKA2_ARATH/15-280 GEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGFDRPSKAVDWLIKKAKTSIDELAELPPWNPADAIRLAAANAKPRRTTAKTQISPSPPpP-.-QQQQQQQQLQFGVGFNGGGAEHPSNNESSFLPPSMDSDSIADTIKSFFPVIGSSTEAPSNHNLMHNYHHQHPPDLLSRTNSQNQDLRLSLQSFPDGPPSLLHHQHHHHTSASASEPTLFYGQSNPLGFDTSSWEQQSSEFGRIQRLVAWNSGGG
Q9S7W5_ARATH/58-293 MKSKDPRIVRVSRAFGGKDRHSKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGVDQPSKAVDWLLDAAKEEIDELPPLPISPENFSIFN---------------------.--.--------HHQSFLNLGQRPGQDPTQLGFKINGCVQKSTTTSREENDREKGENDVVYTNNHHVGSYGTYHNLEHHHHHHQHLSLQADYHSHQLHSLVPFPSQILVCPMTTSPTTTTIQSLFPSSSSAGSGTMETLDPRQMVSHFQMPLMGNSSSS
Q9LEZ9_ARATH/17-195 QRWNNPRIVRVSRAFGGKDRHSKVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPGFHQLN----------------------.--.----------------------------------------------------------------PNLTGLGESFPGVFDLGRTQREALDLEKRKWVNLDHVFDHIDHHNHFSNSIQSNKLYFPTITSSSSSYHYNLGHLQQSLLDQSGNVTVAFS
Q9C758_ARATH/40-241 RIIR------VSRASGGKDRHSKVLTSKGLRDRRIRLSVATAIQFYDLQDRLGFDQPSKAVEWLINAASDSITDLPLLNT------------------------------.--.-----------------------NFDHLDQNQNQTKSACSSGTSESSLLSLSRTEIRGKARERARERTAKDRDKDLQNAHSSFTQL----LTGGFDQQPSNRNWTGGSDCFNPVQLQIPNSSSQEPMNHPFSFVPDYNFGISSSSSAINGGYSSR
Q9C518_ARATH/44-302 LATTSSTATATTTKRSTKDRHTKV----DGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAIVAATGTGTIPANFSTLSVSLRSSGSTLSAPPSKSVPL-.--.-YGALGLTHHQYDEQGGGGVFAAHTSPLLGFHHQLQHHQNQNQNQDPVETIPEGENFSRKRYRSVDLSKENDDRKQNENKSLKESETSGPTAAPMWAVAPPSRSGAGNTFWMLPVPTTAGNQMESSSNNNTAAGHRAPPMWPFVNSAGGGAGGGG
Q9LSD5_ARATH/62-246 NKKSQNQNQLGPKRSSNKDRHTKV----EGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIP--ASA-----------------------.--.---------------------------------------------------LASSAATSNHHQGGSLTAGLMISHDLDGGSSSSGRPLNWGIGGGEGVSRSSLPTGLWPNVAGFGSGVPTTGLMSEGAGYRIGFPGFDFPGVGHMSFASILGGNH
Q9FTA2_ARATH/15-194 EQTSNKGPLNAVKKPPSKDRHSKV----DGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTP--AS------------------------.--.------------------------------------FSTASLSTSSPF-------------------TLGKRVVRAEEGESGGGGGGGLTVGHTMGTSLMGGGGSGGFWAVPARPDFGQVWSFATGAPPEMVFAQQQQPATLFVRHQQQQQASAA
O23875_ORYSA/40-161 SDGATPRRVRPRKSPSSSDRHSKV----AGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTP----------------------------.--.---------------------------------------------------------------------------------------------------------------EEAPPAAVAIGSSSVAAAAAAGGHGGAFVHVPYYTALLMQPPNA
O64647_ARATH/59-280 SLAPPSSTGPPLKRASTKDRHTKV----EGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLENAEPAIIAATGTGTVPAIAMSVNGTL------------------.--.---------------------KIPTTTNADSDMGENLMKKKRKRPSNSEYIDISDAVSASSGLAPIATTTTIQPPQALASSTVAQQLLPQGMYPMWAIPSNAMIPTVGAFFLIPQIAGPSNQPQLLAFPAAAASPSSYVAAVQQASTMARPPPLQ
Q9SJK7_ARATH/27-186 GVSKSSSSGGGCISARTKDRHTKV----NGRSRRVTMPALAAARIFQLTRELGHKTEGETIEWLLSQAEPSIIAATGYGTK-----------------------------.--.------------------------------------------------------------------------LISNWVDVAADDSSSSSSMTSPQTQTQTPQSPSCRLDLCQPIGIQYPVNGYSHMPFTAMLLEPMTTTAESEVEIAEEEERRRR
Q9FLM6_ARATH/52-227 EDQEIQILYEKEKKKPNKDRHLKV----EGRGRRVRLPPLCAARIYQLTKELGHKSDGETLEWLLQHAEPSILSATVNGIKPTESVVSQ---------------------.--.----------------------------------------------------------------PPLTADLMICHSVEEASRTQMEANGLWRNETGQTIGGFDLNYGIGFDFNGVPEIGFGDNQTPGLELRLSQVGVLNPQVFQQMGKEQFRVLH
Q9M1U4_ARATH/1-165 MDSKNGINNSQKARRTPKDRHLKI----GGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWLLQNAEPAIFAATGHGVT-----------------------------.--.-------------------------------------------------------------------TTSNEDIQPNRNFPSYTFNGDNISNNVFPCTVVNTGHRQMVFPVSTMTDHAPSTNYSTISDNYNSTFNGNATASDTTSAATTTATTTV