EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03628 alignment
(3 sequences with 109 aa)


Q9APE7_ECOLI/228-335 HGNLSIDSAHGNYASQAVTIYCDVPVTVKISLFSNTQPAYNN-QGVAVGLGNGWDSIIYLDGVKRNEETLRWNTAGSRTVTVGSKLYGEAGKITSGALSGSMTMIMHLP
Q9AIS9_ECOLI/228-335 HGSIVIDRANGNIASQTLSIYCDVPVSVKISLLRNTPPIYNN-NKFSVGLGNGWDSIISLDGVEQSEEILRWYTAGSKTVKIESRLYGEEGKRKPGELSGSMTMVLSFP
Q47444_ECOLI/228-336 HGDLSINSANNHYAAQTLSVSCDVPANIRFMLLRNTTPTYSHGKKFSVGLGHGWDSIVSVNGVDTGETTMRWYKAGTQNLTIGSRLYGESSKIQPGVLSGSATLLMILP