EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03622 alignment
(2 sequences with 64 aa)


V3B_IBVP3/1-64 MLDFAAIIETGQQIIQQISFNLQHISSVLSTELFDPFEVCVYRGGNYWELESADDCSGDDEFIE
V3B_IBVB/1-64 MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE