EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03609 alignment
(17 sequences with 244 aa)


PTNC_ECOLI/3-238 ITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALGWMN.IGAAVAPDAALASIISTILVIAGHQS...--IGAGIALAIPLAAAGQVLTIIVRTITV.AFQHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFN.LVALGVIGTVMAVLY
Q9CMJ1_PASMU/3-238 ISTLQIVLVFLVACVSGMGSILDEWQTHRPLIACTLIGLVLGDIKTGIIVGGTLELLALGWMN.IGAALAPDAALASVVSTILVIVGGQD...--ISTGIAIAIPLAAAGQVLTYVVRAITV.GFQHAADNVVESGDLNKLDWIHRSALLLQAMRIAIPALIVAMTAGTDTVQTMLSAIPDVVTTGLKIAGGFIAVVGYAMVINMMRAGHLMPFFYAGFVIAAFTEFN.LVALGVLGAIMAVLY
Q9RGG3_LACCA/3-238 ISTIQIILIFIWSSVVGMGSVLDEFQTHRPLIACSIMGLILGDPKTGIILGGTLELIALGWMN.IGAAQSPDSALASTISTILVIVGNQD...--IQKGIAIALPVAAAGQVLTVLARTVTV.AFQHAADREAEKANFTAIIWLHFTALIVQALRVSIPTTIVAVFVSPEEIKSMLDALPEVITGGLAVAGGFIVVVGYAMILNMMSVKYLMPFFYQGFVLGGYLKLS.LLAWGAVGLIFAIVY
PTRC_KLEPN/3-238 ISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILGDLKTGVMLGGTLELIALGWMN.VGAAQSPDSALASIISAILVIVGHQS...--IAIGIAIALPVAAAGQVLTVFARTITV.VFQHAADKAAEEARFRTIDLLHVSALGVQGLRVAIPALVVSLFVSADMVSSMLSAIPEFVTRGLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDFS.LLAFGGVGVIIALIY
PTFC_BACSU/1-235 MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALGWMN.VGLAMAPDTAIASVISTILVITADQG...--IGEGIAVAVALAAAGQALTIFVRTITV.FFIHRADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALIS-VSAVQAFLGNIPDVITKGLQIGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFN.LVGFGALGLCLALLY
Q48521_LACCU/1-235 MSAIQIILLMVVAAITGIGSVLDEAQTHRPLVACTLVGLILGDLQTGIILGGTLEMMALGWMN.VGLAMAPDTAIASVISTILVITAHQG...--LGEGIAIAVPLAAAGQALTIFVRTITV.FFVHKADDYAKNGNFKGIERMHILALVFQALRVMIPTLIICLIS-ASAVSHFLNGIPEVITGGLQIGGGIIVVVGYAMVINMMDVPYLKPFFYMGFLFAAFTNFN.LVGFGGLGLCLALLF
Q9CEX7_LACLA/3-242 YGVLSVILVIVVAFLAGLEGILDQWQFHQPIIACSLIGIVTGHASAGIILGGSLQLIALGWAN.VGAAVAPDAALASIASSILMVQSNNFdltHIMGTIVPAAILLATAGLVLTTLVRMLSV.VLVHQADRAAENGSYSGVEMWHFIALICQGLRIAIPAGLLLVIS-PDAIQKALAAIPPVISGGLAVGGGMVVAVGYAMVINLMATREVWPFFFLGFALAPISELT.LIATGVLGVVIAIVY
Q99YE5_STRPY/4-242 ISIISAILVVIIAFFAGLEGILDQFQMHQPLVACTLIGLVTGHLEAGVILGGTLQMLALGWAN.IGAAVAPDAALASVAAAIIMVKSGDFt.qKGITFAYSTAIPLAVAGLFLTMIVRTLST.ALVHAGDKAAAEGNFAGIERFHFIALLLQGLRIAVPAALLVAVP-TSAVQSVLNAMPNWLNEGMQIGGAMVVAVGYAMVINMMATREVWPFFALGFALAAISQLT.LIAMGVIGVAIAFIY
Q9S4L4_STRSL/4-242 MSIISAILVVVVAFLAGLEGILDQFQFHQPLVACTLIGAATGNLTAGIMLGGSLQMIALAWAN.IGAAVAPDAALASVAAAIILVKGGNFt.tEGIGVATATAIPLAVAGLFLTMLVRTASV.ALVHAADKAAESGNIAGVERAHYLALLLQGLRIAVPAALLLAIP-AESVQHALGLMPSWLNHGMVVGGGMVVAVGYAMVINMMATREVWPFFAIGFAFAAISQLT.LIALGAIGVAIAFIY
Q97SP3_STRPN/1-239 MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLEAGIILGGSLQMIALGWSN.IGAAIAPDAALASVAAAIIMVLGGDFt.kTGIGVAQAVAIPLAVAGLFLTMIVRTISV.GLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMVP-TETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSDIT.LIGFGAIGVAIALIY
Q97TN1_CLOAB/3-240 LNIIQMGLVVIVAFLAGMEGILDEFHFHQPVIACTLIGLVTGNLVPCLILGGTLQMIALGWAN.IGAAVAPDAALASVASAIILVLGGQG..kAGVSSAIAIAVPLAVAGLLLQTICRTIGI.IIIHRMDAAAEEGNIRKIEMWHIIAICMQGVRIAIPAALILAIG-AGPIRSLLQAMPLWLTDGLAIGGGMVVAVGYAMVINMMATKEVWPFFAIGFVLATVSQIT.LIGLGAIGLALALLY
Q97N93_STRPN/1-235 MLFTQALLVTLVGIIATIDYNGPLFMIHRPLVTSAMVGLVLGDFTQGVLIGSALELTWLGVTG.IGGYTPPDTISGAIIGTAFGILSGQG...--ETAGIAIAVPIAVATQQLDVLAKTLDV.YFVKKADNDAKNGDYSKIGFYHYSSLVLITL-FKIVPIFLAIMLGGEYVADLFAKVPPIVMQGLNSAGALLPSIGFGMLLNMMLKKNMWVFLLIGFICSVYGGMS.TIGISLVGIAVAYFY
Q97SK8_STRPN/3-238 INVFQAILIGLWTAFCFSGMLLG-IYTNRCIVLSFGVGIILGDLPTALAMGAIGELAYMGFGVgAGGTVPPNPIGPGIFGTLMAITSAGK...VSPEAALALSTPIAVAIQFLQTFAYTVRA.GAPETAMKHLKNHNLKKFKFTLNATIWLFAF-IGFTLGCLG-ALSMDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNIP.TIGIAIVGTIFALIE
P96163_VIBFU/3-237 IGLFQALMLGLLAFLAGLDLFNGLTHFHRPVVLGPLVGLILGDLHTGILVGGTLELIWMGLAP.LAGAQPPNVIIGTIVGTTFAITTN--...VEPNVAVGVAVPFAVAVQMGITLLFSAMS.AVMSKCDEYAKNADTRGIERVNYFALAVLGS-FYFLCAFLPIYLGADHAGAMVAALPKALIDGLGVAGGIMPAIGFAVLMKIMMKNAYIPYFILGFVAAAWLQLP.ILAIRCAATAMAIID
Q9KIQ3_ECOLI/3-237 ISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAP.LAGAQPPNVIIGTIVGTAFAITTG--...VKPDVAVGVAVPFAVAVQMGITFLFSVMS.GVMSRCARMPRTPILAALNACNYLALLALGN-FYFLCAFLPIYFGAEHAKTIIDVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP.VLAIACPALAMALID
Q9KIP7_ECOLI/4-239 ITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELAFAGLTP.AGGVQAPNPIMAGLMTTVIAWSTG--...VDAKTAIGLGLPFSLLMQYVILFFYSAFS.LFMTKADKCAKEADTAAFSRLNWTTMLIVAS-AYAVIAFLCTYLAQGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSnLLPVAVLGAGFAVYE
Q99ZV2_STRPY/1-230 ------MAALAVLICFGGNYLTGQSMMERPLVVGLVTGLLLGDMKVGILMGASLEALFLGNVN.IGGVIAAEPVTATAMATTFTIISHID...--QKAAMTLAVPIGMLAAFVVMFLKNVFMnIFAPMVDKAAAANHQGKLVMLHYGTWIIYYL-IIASISFIGILVGSGPVNAFVEHIPQNLMNGLSAAGGLLPAVGFAMLMKLLWTNKLAVFYLLGFVLTAYLKLP.AVAVAALGAVICVIS