EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03594 alignment
(8 sequences with 395 aa)


Q9AQS9_9BURK/16-393 GNWSVSAVSAG-LLAVIISYAGPLAIFFQAA---HTAHVGNDVIASWVWSISMGAAVSGIALSWWLKQPIITAWSAPGTALLVTLFPGMPVSEAIGAYIVAGACIFALGLSGWFDQIVKRIPKGIACAMMAGILFQFGVNVFKAVALTPWLALGMLASFLVFRRWAPRYCLILVLAFGGALAVGLGLTHFESVSL--HLTRPVFTMPTWTWQSTVSLAVPLVIVSLTGQFLPGFAILRASGY-QTPTRPVLMTTSLASMLVAFSGGITIVIAAITAALCTGPDAHRDPQRRYVAGIANGLFYLAGGCFAGTVVMLFAALPNAFVAVLAGLALLGAIAANIVGLVQDEAHRE----------ASFITFIATASNMSFLGLGSAFWGIVLGTVAHLV
BENE_ACIAD/10-387 QDWSLSATIAG-FLAVLISYSGPLIIFFQAA---QKAHVSTEMMISWIWAISIGAAVTGIFLSIRFKTPVVTAWSAPGTALLVTLFPNISLNEAVAAYITAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTLPLIVFSMLLCYLISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDF--QIARPQFIAPEWSWFSTLNLALPLILVSLTGQFLPGMAILKLSGY-NTPAKPIIAAASLASLFAAFAGGITIVLASITATLCMGKDAHELKDKRYIAGIANGLFYVLGGVFAGSIVALFSLLPKELVAALAGLALLGAIASNIKIAMQEDQQRD----------PALITFLATVSGMHFLGLSSVFWGMCIGMLAYFI
Q9I374_PSEAE/15-392 ADSSPAAVVAG-FVAMLTGYTSSLVLMFQAG---QNAGLSSAQISSWIWALSIGMGLATIGLTLRYRVPIVIAWSTPGAALLISSLPGVPYSEAIGAFIVCALLITLCGVTGSFERLMRQVPSSLASALLAGVLFRIGIEICNAAEQQTLLVLAMFFSYLLCKRFSPRYAVFAALLVGVLLAGILGQLDFSRFRL--ELAVPEWTTPSFSLAATISIGIPLFIVAMASQNMPGIAVLRADGY-QVPASPLISSTGIASILLAPFGSHGINLAAISAAICTGPSAHEDPHKRYTAALWCGFFNCVAGTFGATLAALFAAFPKALVLSIAAIALLGSIMNGLANSMADERQRE----------AALVTFMVTASGFTLLSIGSAFWGLVAGLLTQFV
Q9L7Y0_PSEPU/6-383 NDSSLSAIVAG-CIATMISYAGPLVIIFHAA---EAAGLSHQQLSSWVWAVSMGSAVLGALLSLRYRVPVVIAWSIPGSALLVTALPQLGLEQAVGAYLVANLLLLLIGISGAFDRIIARLPGSIAAGMQAGILFGFGIEVFRALPVQPLLVLAMFVTYVLMRRVQPRYAVAAVLCVGSLVTLASGAFRSEALVL--ELASPQWITPQFSLPAVFSLALPMVLVALTGQFMPGMAVLRNAGY-ATPASPLISASALAGAVLAPFGCHGLNLAAVTASLCTGHEAHENPRRRYVAAVAGSTLYLLLGIAGATLMSLFAAFPAALIAALAGLALYGAMSEALARSLAEPAERD----------AGLFTFLVTASGVAFLGLSAAFWGLLFGLLAHAL
Q9RY94_DEIRA/39-426 QDTHPSAVLAG-LIAVVIGWAGPNVLIYSVQ---QAGHLSDAAAMSWLWGHAVITGIVGIYLSLRTRMPILSTWSTPGIALLVTALPGMPFAEAVGAFLVSAALVFLLGTFAPLTRAVQAIPTHLAAALNAAILLPFAFKAVQAFGTQPLLVGLMVVTYFLGRQFAPRWAVALVLLVGVAASALLGAWHPAPVPL--APTVPQVVAPAFSVRAMLNLALPLTLLAFTGQFVPGFGVLKANGY-EPAPGPILRACGVASAAAALVGCHNLTLGALLANIVSGPEAHPDAARRYTAAIWAGIFNILFGLFAGTFLHLMGILPAEALAALAGLALLAATGGSLQAAFTPGQSASGRGAAQPGSLAAAVIIAVTLSGVSFFGIGAAFWGILAGLAVHGL
Q98CP3_RHILO/1-376 MTMRLSIPISA-FVAAIVGFGGTLAIVIAAA---HAVGATQIQTASWVTAICLAMAIESLWLSWRTKMPVITAWSTPGLALMAASS-GFSIGEAVAAFIVTAILLIATGLFRPLTQLISRIPPSVASGMLAGIVVTFALNAVKTVPVDPWLILPLIAAFFLIRVFHPALSVLAVLVGGGLAAFLTGRVGGLPTP---ELSTLTLIAPDFTAKAMIGLALPLYLVTMASQNLSGLAVLRAAGY-HPEPGPLIGVTGLFSLLSAPFGGSTTNLAAISAAICTGPDVHPDPAERWKTGPFYALAYVIFAIFGASLVAIFAVLPQSLIVLVAGLALMASLANALAIALKDEGDRM----------AAIVTFVVTASGLTLFGVGAAFWGLIAGLVVLFL
Q9KQM8_VIBCH/4-381 GFFNLSHLSAG-FTTVLVGYTSSVVIVIQAA---TASGANPTQIESWLLTLGVVMGLTSILYSWFYKTPIVTAWSTPAAVMLAASAGQYSLPVVIGAFMFSGALFTLTGMLAPLTRALSKIPVPLGTAMLGAILLPFCAKAFTPLTDTPALFALLFTSYLLAKHLVPRYTMLVLLLVSLGSALALGSFQHADLAL--RIATPIWVMPEFDWLAILNLALPLYLITMLSQNLPGIAMLKSYQY-DAPIKPILVGTGLATLMSAPFGGFSVNLAAISAAICMNEDVDQDKAQRYRAVLWAGGFYLLAGIFAALVVNLFLALPKPISAMLAGLALLGTLMMCLQSAFKIDEYRE----------PALLTFVITLSGATLFGMSATLIGLVIGLAYLRL
Q9RUP7_DEIRA/156-540 APAQPCTVGGGRVPAPYFPRAARRGLSDWGAGGFAAAHSSPAQGASALASMYLLLGVMGMTLCWRYRVPVVLGWNTPGLAVLIASAGRFTAAEVVGALLVSGAVLALVGLSRAFDWLARTLPLPLALALLAGVLLPFVLRGLAAIPQAPALTLPTLLAYLLARVFAPRWAVPLALVTGVTVAALTGQLHLSALGHTSLLARPEWITPTFSSQALLTLALPCTILALTSQHLAGMAVLHTHGYRQVPPALLVTVTGAASALAAPLGSVTMNMGAITAAICMGPDVHPDPNRHYVAGLACAGGYLVLGLCAGALLGLAGSFPAPLMQLLAGLALLGSVLSGLQNALSDPRWRE----------GALLAFACTAAGFSFLNIGGALWGLLLGWGSAAL