EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03548 alignment
(40 sequences with 175 aa)


Q6AM51_DESPS/38-207 RQAEAFSTDFIQEKHLAMLNKPVIFRGHLSLIRPDKLRWQFTSPLPSALIFNGEQGMRCDSEGEATpfLLSSdpVMRVVAEQLWNWLG--GDYLKLSKLYRLS---KMEPASLVIHFDKEgAISKILSRVTIRFNEKSLQPEQVKIVERGGDFTRIFFKNPQLNIPLADDLFSRC
Y864_RICPR/35-188 RTIKSVAIDFTQEDSYGK-----IVKGKLLIQKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQV..----..SRISPSENIFNFLL--EDNVDFDKDFVFE-SVINKGNIFNITIYHT.---RTEKRSEITFNKNIKQIEKLKIFEDH-NIVTITFDKITKVQKFSDDLFKFK
Y1483_AQUAE/33-197 ENTKTIKVSFVQKVKYEWYPKADVSKGIFYASKGGKVRIDYYSPDRVSIFVDRKKVVLVNFEEKVV..YIES..IKRNTSPVIASLFFLSEQPEKVFKP----IGEFKEGDKTVLLLKPL.KKDENVKEVKIYFSKDGE-ILGLKTYDAQGSEISINFIEVVRNYTPTDELFKPS
Q6G1V1_BARHE/46-199 AAIKTMTGDFIQFSPKGK-----MSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTW..----..NFSKLFQTPMKFLL--DDKINISSGRLLA--FREDPGAVTIVLRDK.--SVGAGQIRMVFDSKTYSLRQWTIVDQQNLETTVQIMNVRTGVRFADGMFTLP
Q92L88_RHIME/54-209 SSVKTMAGEFVQFGPRGE-----QTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMKLKTW..----..DIYPLSKTPLNLLL--SERIDLRSRMVRD--VRVEADLITIVLGDR.-SIFGDSTITMMFDPKSYNLRQWTITDAQKKDTSVMIFNVRTGIALDDKVFRIP
Q8UBU0_AGRT5/78-233 SSVKTMMGEFVQFGPRGE-----QTGGKFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTW..----..DLYPLSKTPLSLLL--SDKIDLGNQKVRD--VKEESDLTTIVLGDK.-SVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNVQTGVNLDERVFNIN
Q8FY83_BRUSU/65-219 SSARTMTGEFVQFGPRGE-----QTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTW..----..DLYPLSKTPLKLLL--ADRIDLGGGRLQS--VKQEPDMTTLVLGDK.-SVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTGVRFTNDMFKID
Q98EH4_RHILO/62-217 SSVKSMSGEFVQFGPKGE-----QTGGKFFLERPGKIRFNYDGASNFKVISDGKSVVILNKKMNTS..----..DLYPLSKTPLKLLL--DDRIDLSGDRVKS--VKEEDDLTTIQLSDK.-AVFGNARITMMFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAID
Q984C3_RHILO/43-198 SSVKSMSGNFVQSDPRGE-----KTSGRFFLQRPGKIRFNYTGQSGISLIADGQSVVIYNKKLKTS..----..RLYALSKTPLKLLL--DDKVEFSGNRLKG--IKDDGAQVTIKLADK.-SAFGNSNITMVFDRKSLDLRRWSITDERGQSTTVTLSNVREGVRAPPGTFMID
Q6ND29_RHOPA/147-304 SSLQTLVGQFVQVGPDGS-----KLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQ..----..DVYPLSQTPLRYLL--SDRLDLLRDTNVV-SITSDDLYSNIIIEEK.NAVIGTSRLLLMFGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKID
Q89WR1_BRAJA/85-242 SSLSTLVGNFVQVGPDGS-----KTQGDFYIQKPGKVRFEYDAPSPIDIVADGSSLVVRDRKLATQ..----..DVYPLSQTPLRFLL--SDRIDLMKDTNVV-NVSADDVFVSVTIEEK.QALVGTSRLLLMFGAKDGQLKQWTVTDPQGYDTTIAVYNLDATKKLDPGMFKID
Q9A261_CAUCR/54-210 QGLSSAKGRFVQTDQRGT-----QTQGTFYLQRPGKARFAYDPPAGLLVVSNGNNVNIFDSRLKTY..----..ESYPLSKTPLNLLL--AREVRLDRGVVIT-DVRPLADGFTIVAQDA.-KRQALGRISIDFSNGLVGLMGWTVTDIKGGQIRVRLSDFAETADLDPKLFVLT
LOLA_CAMJE/20-160 LNFNTFSSNFTQIVKSKNSTL--SYSGHFILSKD-QAYWSYDTPSKKEIYINKNQVTIVEHDLEQV..----..IFSHLDNIPNLNEIFKKASLIDKDKLVAK-----------------.---YDNINYTIKLNQEQ--IQSISYKDEFENDVIINLNNQIKNPKINSDVFKAK
LOLA_WOLSU/19-162 ESIGSFRSEFVQTIRSEDGKII-EYRGRVYAKSPYYGLWKYEKPMEKEIYIVDKQVVIYEPALEQA..----..TVSSLQNSIDFMALLRQSKRNSEGIYEAT-----------------.---VFEQKYQILADEKGE-PQKVFFIDKLHNEVQIIFKNAEINPVLEKEMFLFM
LOLA_HELHP/23-166 ENLQSIEADFEQIAVNEDGVPT-RYEGHIIGKMPSKVKWDYKAPLQKEIYMNKNEVIMYEPRLEQV..----..SHSRLKDKADFLSILKSAKKHNDGTYHTK-----------------.---VDGIEYVLFIDKAQK-PERIEFVDSMGVKTTLKLKNVKLNGAISDKKFVFV
Q9ADU7_HELMU/45-186 NGLISIEADFVQITHQGSQKL--IYTGKLYAKNPSLAKWIYETPLKKTIYLNKKEAIIYEPMLEQA..----..TFTHLTKQVDFFAILHKATLGQDGKYHAK-----------------.---VGDAQYVLSFAKNL--PHKITFIDELQNKIEIILKNLKVNPTLSDGIFVFT
LOLA_HELPY/33-173 QHLQSFSAHFKQVLKNEKPL---VYYGVLKAKAPNWALWVYEKPLKKEIYMNDKEVVIYEPNLFQA..----..TITPLKDKTDFFTILKRLKKQDDGSFKTT-----------------.---INKTTYRLVFKDGK--PFSLEFKDGMNNLVTITFSQAEINPTIANEIFVFK
Q72BG8_DESVH/37-203 DTVTTLKAAFTQKLLHRESGSTETRNGTLLFRKPLLVRWETGGKNPEVLVISSQDIWNFLPDEELA..YRYP..LDLVQDSKSIIKVI--TGQAKLDQDFNVV-EEGQEEGLTRLHLYPK.EPVQQLTEAILWVDPQEHLIRRVRVYDFYGNENEIDFTSLEANATVADKAFTFT
LOLA_SHEON/32-191 TGTESLKADFKQTVTDVNKKVIQSGAGVFALAHPNQFYWHLTAPDESKIVADGKDLWIYNPFAEEV..VIMD..FTQAITASPIALLV--HRDDATWSQYAVT------KKQDCYEIKPK.ATDAGISAVNVCFNKGT--LNKFNVLDDKGNLSQFDLSNQHSISTGDKALFKFV
Q6LT02_PHOPR/29-188 SLVNAFSANFDQKVVSPEGDVLVEGKGDVTIKRPNLFRWNTVTPDENLLVSDGKTLWYYSPFIEQV..TAMW..LKDATEQTPFVLLT--RNSASDWDNYNVA------QTSDTFTLTPK.DTTSTMGKFVVTVAKTGE-VRNFSVVEQDGQRSNFKFRQFS-KQVPKANIFTFT
LOLA_VIBVY/27-186 GMNDGFSANFNQTVTSPEGEVVMEGEGSVDIARPSLFRWSTSLPDENLLVSDGKTLWYYSPFIEQV..SIYW..QEQAVQQTPFVLLT--RNQSSDWENYQIT------QDGNVFTLVPK.AADSTQGQFQIDIDAKGI-VHGFNVIEQDGQKGIFKFTDMK-LGKPAAARFTFN
LOLA_VIBPA/37-196 AMNEGFSADFSQQVISPEGETVMEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQV..SIYW..QEQATEQTPFVLLT--RNRASDWDNYKIS------QKGNEFTLIPT.AVDSTQGQFQINIDAKGV-VKGFNVIEQDGQKGLFTFSNVK-LGKPKADRFTFT
LOLA_VIBCH/27-186 AMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQV..TLYR..AEEALEQTPFVLLT--RNKASDWDAYHVE------EKGDVFTLTPT.ALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKVK-QQKPNASVFNYK
LOLA_HAEDU/36-195 EHVAQYSADFEQTVRSSKGQQIQSGRGKFQVKRPNLFRMDINAPQENVIVSDGENLWFYDPFVAQV..TVNS..VQNAVNGTPFVLLT--SSDKQHWTQYEVT------QNADTFVLKPK.SAKNNLRQFDVQIDQNGL-LKGFSTIERDGQTNLYRLRNIT-TADLSADLFKFS
LOLA_PASMU/33-192 SKVNVLSADYAQTVSSSDGKNVQQGSGTLKIKRPNLFRMDNKTPQENQIISDGKTLWFYDPFVEQV..TANW..VKDAVNNTPFVLLT--SDDSSHWAQYNVE------QKADTFTLKPK.AKQSNIKQFDIRIDSEGV-LRNFSTIEKDGQTNLYILRNIT-NQPLADGIFKFS
LOLA_HAEIN/33-192 AKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPNLFRMETKTPQETQIISDGKTLWFYDPFVQQV..TAQW..VKNAVNNTPFVLLT--SNDKSHWHQYTVT------QQSDTFVLKPT.LSTSNIKQFDIRVDANGI-LRNFSTTEKDGQTNLYVLRNIT-NQTLSDSLFQFK
LOLA_PHOLL/32-191 GKVNSFHASFTQTVTSDDGATIQEGEGQLWVKRPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQV..TANW..LKDATGNTPFMLIT--RNDAKEWSQYKIS------QQGNDFELTPN.NVTGNLKRFSITVTTDGT-IQKFSAIEQDGQKSAYQLKGQQ-NTHVDAAKFSFT
LOLA_YERPE/32-191 SKVNSFHASFSQAVTSSDGAVVQEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQA..TATW..LKNATGNTPFMLIT--RNNPDDWKQYNVK------QKGDDFELTPK.SASGNLKQFAISVTPSGT-IKSFTAVEQDGQRSAYTLKSQQ-SSVVDASKFTFT
Q6D3U8_ERWCT/32-191 NKVNSFHANFSQKVTSTDGAAVQEGEGELWLKRPNLFNWKTTSPDESALISDGKTLWFYNPFVEQV..TATW..LKDATGNTPFILIT--RNDTSDWNKYDVR------QKGDDFELTPK.SASGNLKQFAINVTTNGT-IKQFTATEQDGQRSTYVLRNQQ-NGVVDAAQFTFT
LOLA_ECO57/32-191 DKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQA..TATW..LKDATGNTPFMLIA--RNQSSDWQQYNIK------QNGDDFVLTPK.ASNGNLKQFTINVGRDGT-IHQFSAVEQDDQRSSYQLKSQQ-NGAVDAAKFTFT
LOLA_BORPE/38-200 ATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDGKQVFQYDPDLAQV..TVRQ..VDQAIGTSPAAILF---GAGQLSQAFAVS-ALPDRDGLQWLRAKPR.NADAGFSQVDIGLRDNQ--PARIELVDAFGQTTRVELSNLL-PGAVPASEFQFT
LOLA_XANCP/32-197 RGLKGLDGQFSQRVTDANGRVKENSSGRVALATPRQFRWEYAKPYKQLIVADGKKVWVFDPDLEQV..TVRA..QGSEEQNSPLVALI---DPTRLDKQYDVSEEAAPRDGLQWLSLTPKvDTDASFQMASLGFGKDG--LAKMEVVDAVGQRTAISFSGWKRNPAFAADTFRYT
LOLA_XYLFA/34-199 RGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQA..SVRL..QGNEERNSPLIALI---DPIQLDLKYDVSEEVAMRDGLRWLSLRPRvGIEASFQSASFGFAQTQ--LARMELVDNLGQRTVIVFSGWQRNPVFAVDTFRFT
LOLA_NITEU/32-196 NKALTFQANFSQTLLDKNFQVIRKASGSMMFERPGKFRWTYDQPYQQLIVGDGKQVWFYDQDLAQV..TVHR..LDQALGSTPAALLA---GGNTIERDFNLQ-EIDVQGETEWLEAIPK.NQENSFELIRLGFSKTGI-LREMVLRDSFDQVTWLIFSEIEQNPTLTPDLFQFT
LOLA_CHRVO/34-195 SGSKTLSADFNQTVTNKGKR--EEASGRLEIARPGKFRWEYTKPYAQLIVGDGKTLWIYDQDLAQV..TRKA..QGAALGSSPAALLA---GNNEIERSYKLN-EAGKQGDLEWLAASPK.KQDNTFSAIRMGF-KNNV-LVEMQLTDSFGNDTRIVFSQQRQNAALPPARFAFA
LOLA_NEIMA/36-197 NDADGISGSFTQTVQSKKKT--QTAHGTFKILRPGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQV..TKSS..QDQAIGGSPAAILS---NKTALESSYTLK-EDGSSNGIDYVLATPK.RNNAGYQYIRIGF-KGGN-LAAMQLKDSFGNQTSISFGGLNTNPQLSRGAFKFT
LOLA_PSEPK/34-197 EKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQA..TIKK..LDVRLNQTPALLLS--GDVSKISQSFDIA--SKEQGEVMDFTLKPK.TKDTLFDSLRVSF-RKGL-INDMQLIDSVGQRTNILFNGVKANQAVPDSKFKFD
LOLA_PSESY/34-197 EKSQTLTARFSQLTLDGGGTQLQETTGEMALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQV..TIKK..LDQRLTQTPALLLS--GDVSKISESFDIT--AKEAGGVIDFTLKPK.TKDTLFDSLRLSF-RNGI-INDMQLIDSVGQRTNILFTGVKANESIAASKFQFQ
LOLA_PSEAE/35-198 NKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQV..TIQK..LDQRLTQTPALLLS--GDISKISESFAIT--YKEGGNVVDFVLKPK.TKDTLFDTLRLSF-RSGK-VNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTFD
LOLA_COXBU/37-201 SNFRTYQAKFNQITFDGQDRVIQQSHGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQA..TQQP..LAQKTNINPASLLS--GSVKDLKQKFTIT--ISPTPDAATFQLVPNlGKSLNFNWIRLKFSKKQ--LTEMTVLNNLDERSIFQFSQIKVNAPLSSTLFEFK