EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03539 alignment
(5 sequences with 163 aa)


POL_SFV1/26-188 IKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWLMKKPLQLTVLVPLHEYQERLLQQTALPKEQKELLQKLFLKYDALWQHWENQVGHRRIKPHNIATGTLAPRPQKQYPINPKAKP
GAG_FOAMV/645-807 IKGTKLLAHWDSGATITCIPESFLEDEQPIKKTLIKTIHGEKQQNVYYVTFKVKGRKVEAEVIASPYEYILLSPTDVPWLTQQPLQLTILVPLQEYQEKILSKTALPEDQKQQLKTLFVKYDNLWQHWENQVGHRKIRPHNIATGDYPPRPQKQYPINPKAKP
Q9J4C7_9RETR/11-173 IKGNSLKGFYDTGAEITCVPAIFLIEEEPIGERTIQTIHGITKEKVYYLTFKIQGRKLAAEVIGTQLDYVIIAPSDIPWYKKYELELTIKIDIQKQQEQLLHTTNLSSEGKKYLKDLFIKYDNLWQKWENQVGHRRITPHKIATGTLNPKPQKQYRINPKAKA
O41894_9RETR/11-173 IKGNHLKGYWDSGAEITCVPAIYIIEEQPVGKKLITTIHNEKEHDVYYVEMKIEKRKVQCEVIATALDYVLVAPVDIPWYKPGPLELTIKIDVESQKHTLITESTLSPQGQMRLKKLLDQYQALWQCWENQVGHRRIEPHKIATGALKPRPQKQYHINPRAKA
O93209_9RETR/11-173 RKGVKIKGYWDSQADITCVPKDLLQGEEPVRQQNVTTIHGTQEGDVYYVNLKIDGRRINTEVIGTTLDYAIITPGDVPWILKKPLELTIKLDLEEQQGTLLNNSILSKKGKEELKQLFEKYSALWQSWENQVGHRRIRPHKIATGTVKPTPQKQYHINPKAKP