EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03522 alignment
(3 sequences with 30 aa)


S12A6_HUMAN/1018-1047 VKDRNSMLRLTSIGSDEDEETETYQEKVHM
Q98SU0_XENLA/229-258 VKDRNSILRLTSVGSDDDEDTEAAPERVHM
O18887_PIG/953-982 VKDRHSALRLESLYSDEEDESVAGTDKIQM