EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03520 alignment
(2 sequences with 242 aa)


KCNQ1_SQUAC/410-645 KRKKLKTDKDNGLN-SEKSLNVPNITYDHVVDKDDRKFENSNIDGYDSSVKKSLGILDVNSGALSRANSYADDLDFIEGEPVLAPITHVSQLRESHRVTVKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPTMFLSVSEKSQDRGKNTIGARLNRVEEKFVHMDQKLNTITDMLHHLVAHQQGHPHPQTQPQAQ-----GTVVQAVASTHSSLPSYE
KCNQ1_MOUSE/418-655 KKKKFKLDKDNGMSPGEKMFNVPHITYD---PPEDRRPDHFSIDGYDSSVRKSPTLLELSTPHFLRTNSFAEDLD-LEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYE