EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03517 alignment
(5 sequences with 85 aa)


ICLN_XENLA/30-111 LGPGTLYIAESRLSWLNGSG--LGFSLEYPSISLHAISRDTAAYPEEHLYVMVNSKLADKEDKEAHMADQEEEESEDDDD-DEEP
ICLN_MOUSE/32-107 LGTGTLYIAESRLSWLDGSG--LGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKLG--EESKEPPSD----EDEEDND-DIEP
P79725_BRARE/30-111 LGLGTLFVAEAQLSWFDGSG--MGFCLEYPTISLHAISRDLSAFPEEHLYVMVNAKLDD-EGEAAPLEKDPDEEDEDEEDSDSES
Q17564_CAEEL/29-107 LGNGTLYITDSAVIWISSAAGTKGFSVAYPAIVLHAISTDVSVFPSEHIFVMVDQRKSGLELAAAELED-----EESDDD-EEEP
Q9LVA7_ARATH/46-120 ESPGTLYITSRKLIWLSDVDMAKGYAVDFLSISLHAVSRDPEAYSSPCIYTQIEVEED----EDDE-SD-----SESTEVLDLSK