EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03510 alignment
(5 sequences with 107 aa)


POLN_MANCV/997-1103 GYGVHIGNGNVITVTHVASTSDEVNGSAFKITRTVGETTWVQGPFSQLPHMQIGSGSPVYFTTRLHPVFTISEGTFETPNITVNGFHVRIMNGYPTKKGDCGLPYFN
Q9QEJ5_9CALI/1063-1169 GWAVHIGNGRLVTCTHVANMCDRVAEVEFKVAETDRDTCIITAPLGHLPSVALGNGPPAFYTTNFHPIRVLDEGSWDTTTTRVTGWRVVINNGTTTAPGDCGQPYLN
Q86114_RHDV/1120-1218 GRMIHIGNGLYISNTHTARSS----CSEIVTCSPTTDLCLVKGEAIR-SVAQIAEGTPVCDWKKSPISTYGIKKTLSDST-KIDVLAYDGCT--QTTHGDCGLPLYD
Q9QRV9_9CALI/1095-1199 GYCVHMGHGVYASVAHVVKGDSFFLGERIFDIKSNGEFCCFRSTKILPSAAPFFSGKPTRDPWGSPVATEWKPKPYTTTSGKIVGCFATTST--ETHPGDCGLPYID
O92368_9CALI/1208-1312 GYAIHIGHGVYISLKHVVSGNAKILSEDPKDLKINGELATFRLNSILPTAVPVGTSKPIKDPWGNPVSTDWQFRNYNTTSGSIYGACGSSCS--LTRQGDCGLPYVD