EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03504 alignment
(2 sequences with 95 aa)


Q9AF83_9CHLA/88-182 CYGKMYSVRVNDDCNVEISQAVPEYATVGSPYPIEILAVGKKDCVNVVITQQLPCEVEFVSSDPVTTPTSDSKLIWTIDRLGQGERCKITGWVKP
OM6D_CHLTR/88-182 CFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKP