EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03494 alignment
(2 sequences with 39 aa)


Q9I9E7_BRARE/517-555 EAEERHSEVYHQKLVFFAEDVSSNKGAIIGLMVGGVVIA
A4_SAISC/656-694 FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA