EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03468 alignment
(9 sequences with 122 aa)


Q9LUV5_ARATH/52-162 QAQLIIWPPHVIVQNTSTGKGKEGRM-EGF-GNKTMDNRIRELGLTGGKSKSLYG.REGHLGITLFKFAGDDSGLRDAMRMAEYFEKINRGRKSWGRVQ--------PLTPSKDDEKNPGLV
Q9S9P3_ARATH/114-228 PHNVYVWPWMGIVVN-PLKEADD-KELLLDSAYWL-QT---LSKFKPIEVNAFWV.EQDSIVGVIAKFNGDWSGFAGATELEKEFETQGSSKKEWTERSGDSESKAYGWCARADDFESQGPI
Q9SAI1_ARATH/114-228 VDDIYVWPWMGIVIN-PVRRTDN-KNVLLDSAYWL-KK---LARFNPLEVKTLWL.DQESVVAVIPQFNSGWSGFKSVTELEKEYEIRGCGRKDWIDKRGDWRSKAYGWCARADDYNSQGSI
Q9M150_ARATH/28-146 QQKRYVWPWVGLVANVPTEVEPSGRR-VGKSGSTLRDEFT-LKGFNPTRVKPIWN.TKGHTGFALVEFAKDFKGFESAMQFEKSFDLDRHGKRDWKKGHRLRDDKLYGWLAREDDYNRSDTV
Q9SMN2_ARATH/123-240 HDEKLVYPWKGIVVNIPTTKAQDGRS-AGESGSKLRDEYI-LRGFNPTRVRPLWN.YLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGP-KLGLYGWIARADDYNGNNII
Q9LHB1_ARATH/116-233 QFEKLVWPWKGVLVNIPTTSTEDGRSCTGESGPKLKDELI-RRGFNPIRVRTVWD.RFGHSGTGIVEFNRDWNGLQDALVFKKAYEGDGHGKKDWLCGA--TDSSLYAWLANADDYYRANIL
O48878_SORBI/85-199 RDEKFVWPWMGILVNVPTE-WKDGRQ-IGESGNRLKEQ---LSHFCPLKVIPLWT.FRGHTGNAIVEFGKDWNGFRNARTFESHFAAGGFGKKDWTGKKNQ-GSELYGWLARAEDYNSPGII
Q9SBW2_ORYSA/111-225 RDEKFVWPWMGVLVNVPTE-WKDGRQ-IGRSGNHLKEQ---LSRFCPLKIIPLWN.FRGHSGNAIVEFGKDWHGFRNALAFEDYFGKEGYGRRDWKEKQNQ-GSNLFGWVARAEDHTSPGLI
Q9LMH6_ARATH/215-334 GDQMYVHPWKGILANMKRTFNEKTRKYAGESGSKIREDLI-KKGFNPHKVTPLWNgRLGFTGFAIVDFGKEWEGFRNATMFDKHFEVSQCGKRDHDLTR-DPGDKLYGWVAKQDDYYSRTAI