EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03465 alignment
(35 sequences with 146 aa)


Q98RP4_GUITH/277-409 CIKEKKIIESFFDEIEK.DTGKYVYGCEETCNSLTNGFLSKIILWENLEIERMVYIDS---..FTNLEIVKFKKINECDKTECLDEN--..PKLVFSAKCNVIDWVIENKNKCETQIYIITDRTPEGAQFVKGFGGIGGILKF---
ERF1_GIALA/290-433 LIQEVKLLTEFTENIAK.DTKRVCFGITDTIRCLEMSAVEKLIVWDDLPYHRVT-LQCVINgeTSAPVIKYLLKSQMSNPKYLREVINGeeVQLDIMGDQLLLEWFVDNYKNYGASLEFITNRSAEGTQFCSGFGGIGGLLRWQVD
ERF1_TRYBB/281-421 LVQEKKLLQGFFDQIAC.DTQLYCFGVQDTLKCLEAGAVETLIVYEDLNIYRYTVVKNRGA..DDEETFVHVMSEEEAKRSNIHMQESG..KTRNEIEQEDFVDWLATNYRKFGCALELITNRSQEGTQFVRGFGGIGGVLRYKLD
ERF1_SCHPO/277-417 YVQEKKLIQRFFDEISL.DSGKYCFGVVDTMNALQEGAVETLLCFADLDMIRYE-FKNSEG.nPVITYMTKEQEEKDSTNSFLLDKDTG..AEMELVSSMLLSEWLAEHYKDYGANLEFVSDRSQEGMQFVKGFGGIGAVMRYQLD
Q9BMX1_EUPAE/276-414 FVEEKNLISKYFEQIAL.DTGMIVFGVEDTLHSLEIGALDLLMCFENLEINRYE-IRDSA-..NDEIKIYNLNKEQEKDPKYFKNEKTG..ADLEIIKSGPLSEWLCENYSKFGIKLEFITDKSQEGFQFVNGFGGIGGFLRFKLE
ERF1_STYMT/285-423 FVAEKKLVSKFFEEISL.DTGMIVFGVQDTMKALELGAVETILLFEELEITRYV-IKNPV-..KGDTRTLFLNPTQQKDSKYFKDQASG..LDMDVISEDQLAEWLCHNYQNYXAQVEFITDKSQEGYQFVKGFGGIGGFLRYKVD
O96203_PLAF7/276-412 FIQEKKLIGKFFEEIAQ.DTGKVVYGIDDTLKALEIGAVELLILYEGLDIIRLT-TKNPV-..TNQTKTMHISPCDEKQESLYK--ENN..VELEVVEKISLTDWVIGNYKKYGASLDFVTNKSQEGAQFQKGFGGFGGMLRYKID
ERF1_PODAN/281-419 FIQEKKLIGKYFEEISQ.DTGRICYGVEDTLKALELGAVETLIVFENLEVTRWV-LKDSN-..GAEIIIHSTKQQDAANRDRFMDKETG..QEMEVVSQESFLEWIAEHYKDFGTTLEFVSDRSTEGNQFVKGFGGIGGILRYKVN
ERF1_CAEEL/288-425 FIQEKKLIGGYFDEISQ.DTGKYVFGVKDTLAALEMGAIETLICWENLDIVRYK-MKNSLG..--EDILLNLRPDEEKDKSHFTDSETG..QDMEIIETMPLLEWFANNYKNFGAALEIVTDKSQEGAQFVRGFGGIGGLLRYRVD
ERF1_BLEAM/280-416 FIREKKVMSKFFEEVAQ.DTKKYCYGVEDTMKSLLMGAVEVILLFENLNFTRYV-LKNP--..-TTGIEKTLYLTPEQEENHDNFIENG..EELEALEKGPLPEWIVDNYMKFGAGLEFITDRSQEGAQFVRGFGGLGAFLRYQVD
ERF1_TETTH/279-415 FVQEKNVISKFFDCIAI.DSGTVVYGVQDTMQLLLDGVIENILCFEELTTLRVT-RKNKV-..TEQITHIFIPPNELNNPKHFKDGE--..HELEKIEVENLTEWLAEHYSEFGAELYFITDKSAEGCQFVKGFSGIGGFLRYKVD
RF1_SULSO/275-369 YIEVEKLLEELKYHLAK.DDGLIIYGKEQIKKAMEIGAIEAIVIHEDSTDKE---------..--------------------------..-----------LEKLAQDAENYGVKVFVVGDEVPEAEWVKKTFNGIVGKLRYRLY
RF1_AERPE/279-371 YRDAVNAMEEFKLHLAK.GTGMIVYGEKDVEAALEMGAVKTLLIHESRED-----------..--------------------------..-----------LEEWVEKAKSSGAQVIVVPESLAEAEWFLKTFGGLAGILRFRIS
RF1_METJA/277-420 LMKEREAVQRFLKELIKeDGGLACYGEKEVLEALMMGAVDTLIVSEELEKYKVKIACNNCDylEEKTVNKLELIKLEEELKNAQCPKCG..GALSIVEEKDYIEYLSELCEQSGAKLVTVSSETEEGAMILNAFKGIAAILRYKIH
RF1_THEVO/277-411 ISREKDLMDRFLREVKKpDGGLAVYGEKAIRDALEQKMVDLLLISEGIRRVKYT-YKCP--..----TCGEEKTFSEEPSEWPVCDKDG..TPLELIGEDDMIEDLYKLAKESGAQVEIISDQSDEGKLLKQAFGGLAAVLRFIRK
RF1_PYRHO/278-417 VIREKKLVNEFLKHVVK.DTGLATYGEREVRRALEIGAVDVLLISEGYNKVR-VRVKCNHC.gWEELKTMSEEEYEVYRKKITKCPKCG..SQNLTIEKWDVAEELIKMAEEAGSDVEIISLDTEEGQQFYRAFGGLGAILRFKI-
RF1_METTH/274-407 VMREKKLVQRFLRELIN.EDGLASYGEREVRQHLQMGAVEVLLLSEDLKYQRGTY------..ECASCGHRMEKTGRDLPDTETCPSCN..DQMRLSDRRDMIDDLVEMAEEVGTEVEIISTETEEGMQLLRAFGGIGAILRYRP-
RF1_ARCFU/270-403 IIREKNLMQRFLKEVAR.D-GLAAYGEEEVRRYIELGAVDTLLLSEDLRYER-VKYR----..CPKCGKEVEVTVREGIEKPPFCEEDN..VEMEEVERRDIVLELSELAESTGAKVEFLSTESEEGEMLYKAFGGIAAILRFKP-
P96026_SULSO/245-344 IAIGAKKMEKAMELLAK.QPELVTYGLEQVKNAIEMGAVETVLVIEDLLSS----------..--------------------------..DEQERLT----IERMLEDIENKRGEVILVPKESPIYFEL-KNLTGILAILRFRIN
Q9HPR5_HALN1/254-357 IAEESELIDELTTQMAT.D-GKAAYGIDEVQKAVEFGAVEDLLILDERLRLERAGE-----..-------------------------GdwVDVD-------VNDLVRTVEQQGGSVTVFSHEFAPGEQL-RNLGGIGAVLRYRLD
O29421_ARCFU/246-343 LAEEAEYIDRLLEGIAK.G-ERVAYGLDEVREAHNYRAIEVLLVADEFLLEE----REKWD..--------------------------..-----------VDGLLREVEESGGKVVIMSTEFEPGKRL-MSLGGIAALLRFNVK
Q9V0V3_PYRAB/260-356 VAQEIKLVEKVIERIAK.D-EPVAYGLKDVEEAVNYGAVDTLLVLDELLKG---DDRE---..--------------------------..----------RIEEIMEMARNLRANVVVVSSEHEGGDKL-KALGGIAAILRFKIH
Y174_METJA/254-347 VAKETQLIEKLLEEIAK.K-GLAVYGIDEVKKALEYSAIDTLLVSDSLVRNH---------..--------------------------..----------EIEKIIDTTEEMGGKVVIVSSEHDAGKQL-KALGGIAGLLRFPIE
O27679_METTH/266-360 IASEIRNVNEFLEKLAR.DPDSVVYGKVEVMDAINMGAVEKLLVLDRVVSRED--------..--------------------------..-----------IEGYLDMVESMGGSVVLISSEHEGGKQL-ESLGGLAGILRFKIQ
Q9USL5_SCHPO/271-371 YVQEIRVLNKFYDVMNE.DDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKK--..--------------------------..-----------WVSLVEGVKEINCPVYIFSSLHESGKQL-DLLSGIAAILTYPVD
YNU6_CAEEL/271-371 AQGEVKALNQFLELMST.EPDRAFYGFNHVNRANQELAIETLLVADSLFRAQDIETRRK--..--------------------------..-----------YVRLVESVREQNGKVHIFSSMHVSGEQL-AQLTGCAAILRFPMP
Q9ZT87_ARATH/271-371 AAKEVKALNDFHNMLST.EPDRACYGPKHVEVANERMAIQTLLITDELFRNSDVKTRKK--..--------------------------..-----------YVNLVESVKDSGGDAFIFSAMHVSGEQL-AQLTGIAALLRFPLP
PELO_HUMAN/271-371 AAGEVKALDDFYKMLQH.EPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSR--..--------------------------..-----------YVRLVDSVKENAGTVRIFSSLHVSGEQL-SQLTGVAAILRFPVP
PELO_DROME/271-371 AAGEVKALEQFYMMLQC.EPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKE--..--------------------------..-----------YVNLVESIRDAGGEVKIFSSMHISGEQL-AQLTGIAALLRFPMP
P79004_SACPS/277-377 LIKEIQIMDDFFEHLNK.DDNKAWYGKEEIKRAAKLEAVETLLITDTVLKSDDIDERET--..--------------------------..-----------FLDLTYNIEQSGGRVFVFSTLQSHGEEL-GRLKGLACILKYPIP
DOM34_YEAST/202-302 YSKEIMVMDEFLLHLNK.DDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQRE---..--------------------------..----------EYLKLMDSVESNGGKALVLSTLHSLGEEL-DQLTGIACILKYPLP
Q9YAZ5_AERPE/238-338 IVEAEGVLEEFLRRIAK.SRDTVAYTPGEVLAVARMGAVDTVLLVDTLLHSPDDAVREA--..--------------------------..-----------VDEALRLVESMGGRVIIIPGDSPAGERLV-SFGGVIALLRYPVP
RF1_HALN1/281-415 LMDDKSDMEEFFEELN-.GGKLATYGFEQTRRNLIMGSVDRLLVSEDLREDVVIYE-----..CPNDHEEYETIDRRNTSPEHTCSDCG..EEATEVDREDAIDHLMSIADQRGTETHFISTDFEKGEQLLTAFGGYAGILRYSTG
Q9HJ74_THEAC/247-339 IARDKEIVDEFLVAVKK.D--MGVYGRDQTESALQMGALSDLIITDEMFRT----------..-----------------------EDG..------------RRSLSIAQTVGTRIHIVSVSNDPGQIV-KKFGGFAGILRYRVQ
Q97BJ3_THEVO/247-339 ISRDNEIVSAFLSSLRR.G--SGIYGSEEIRKYLEMGALSDLIITDKKFRS----------..-----------------------ETG..------------RELLSLARSVGTDIHIVSTSNDMGEII-EKFGGYAGILRYKVQ