EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03448 alignment
(51 sequences with 135 aa)


Q9X0P4_THEMA/3-131 IKVEIDLQELIEKGDFKTLKRVLEQQDPA.DVKEMIEKLPPDLKVVVFRLLP.KDKAAEVFSELEPDDQLE..LIKLFREERLKEIFE.SMDPDDRVELLEEMPANVVKKLLSYL.PPQEREELLYILNYPEDSA
Q8YWD1_ANASP/18-144 TQDVR--IALMDVADLNQLKWDLNRLQPV.DVGEYITQLPEKQRAIAFRLLN.KNQAIDVFEYLPTEVQEE..LINSLHDAQVVQLVE.EMSPDERAELFDELPAGVIKRLLREL.SPEQRQATATILGYPEGTA
Q8YLW2_ANASP/21-149 DLVRTQMRMLLEAGDLQGAKAILVPVQPA.DIAEAIEGLPETMHALAFRLLS.KDEAIEVYEYLDYSVQER..LIEELKSQEVRDIVD.QMSSDDRARLFDELPAKVVNHLLEQL.SPTERQATALMLGYEADTA
P73368_SYNY3/19-147 KLVRAQIETLLETSQFDAAKTILTPVQPA.DIADVIESLPSRLQVLAFRLLS.KNEAIDVYEHLAPPVQES..LLEDFKHPEVLEIFN.QMSPDDRVRLLDELPAKVVRQLFKHL.SNEERKATSLLLGYKPETA
Q8KBD4_CHLTE/4-132 TPILPEIRELIEQRNFSALQRLFDDWLPV.DLAELISDLPENEQAILFRLLP.KDVATETFEYLDFDAQQN..LLNALTQKDVTHILN.SMSADDRTALLEELPGPVAQELIKLL.SFKEFKIAKTLLAYAEDSV
Q8PWC9_METMA/2-127 HSEFK---ELLDKRDWEGLRVLIREMKPS.EIEDLYFELDGRDFVILFRLLE.KDLALEIFESFSVEHQVE..IIKLMEEADTIDLLE.PLDPDDCARIFEELPAKITKRLLNGL.SPERRKYVNLLLGYPEGSA
Q895C8_CLOTE/5-133 KKEFEEIISLIHEKKFHNAREKILELNPV.HISDIIECLDISEAILVFRMLP.KDMAVDVFNYLEKDFQTN..IITGITDKEIKHIIE.EIYFDDMIDLLEEMPANVVKKILKYS.NVEERKLINEFLNYPEDSA
Q8RDN1_FUSNN/4-132 GIKLEEIIQLLEQNRLAELKEILIKENPI.DVADVFEEFPKEKDLIIFKLLP.KDFSSEVFSYLSPEKQQE..VIENITDEEIKFIME.DMYLDDTVDFIEEMPANIVDKILKNT.SHDKRKLINQMLKYPENSA
O83887_TREPA/2-130 NENFEKIQTLLEHKRYVPLIANLNEMNEV.DVAHVLDMQSPAQALLLFRMLP.KNLAANVFAQLSSSKQSA..FLATITDRELAPILA.ELAMDDIVDLVEEMPANAVKRILAQT.GETERQVINQLLKYPEDSA
O50166_BORBU/1-129 MIDIDELRIFLKEKSYSKIKEKFLKXDSX.DIAEALKRLNGTELILLYRFLP.KKIAVETFSNFDQSTKNK..LANSFTNKEISEMID.ELNLDDVIDLLEEVPANVVQRFLASS.TEENREIINKFLSYSDDSA
Q8FUE7_COREF/31-159 LEQILREDSEVAPGGARKISELLGSIGLK.DLIHVLERMPSVRAALILRLLP.RRRSIEAFEALDAAHQAD..LVDALGDDSLVSFFD.ALDPDDRVSLLDELPAEIAERLMRSL.EESQHDLTSVILGYPKGSI
Q8NTS8_CORGL/8-136 LRGEVCDMKELELGEARDVAATLEAMPIQ.EVIDQVERTSITKGAVLLRLLS.KDRSLLVFDALGPRLQAD..LIGAFQDAEVLDYFA.DLDPDDRVSLLDELPASIADELLRSL.DPQEKQVTELVLGYAKGSV
Q9S0K7_SHEVI/12-140 DQRLNRLTQALGSGMFVHVRNMLHDMAAS.DVAFILESSPPRTRQVLWQLID.LDHTGEILDELGEELKDN..LIKQMTPERVAKAAA.GMDTDDLAYILRSLPDSVFNKVLQSM.SSQDRTRVEQALSYPDDTA
Q8EAE0_SHEON/12-140 EHRLDQLSQALNSGMFVHVRQMLQNMASS.DIALILESSPPKARQVLWQLID.QDQLGDILDELSEELKDP..LIRAMSPERVAKATA.SMDTDDLAYILRSLPDTVYKQVLQSM.SLQNRQRVEQALSYPDETA
Q8DE98_VIBVU/11-139 HQALQEVSEALENGRFVHVRRQLQDMEPE.DIAHLLEASPRKSREVLWQLTD.PEDYGEILDELSEDVKDS..LVSKMAPEDLAEATE.GMDTDDVAYVLRSLPDNVSREVLAQM.DAADRLRVETALSYSEDTA
Q9JWC7_NEIMA/43-171 IENGTPLEDAPLRDKLTELTVLLSELHPA.DVAAVLESLPPRERNIVWILVK.PEDDGEVLLEVSDAVRET..LIESMDKDELLAAVD.DLDADELAELADDLPHQVVYEALQTR.DEEERAQVKAAMSYEDNQV
Q885I7_PSESM/39-167 GQNQDRVENLVHRQNLVELQRKLEDLHSA.DVAYILEALPLEDRLTVWQLVK.ADRDGDILLEVSDSVRET..LIADMDDHELLAAAR.DMDADELADLAPELPRDVVHELMEAL.DSQQRERVRSALSYDEDQV
Q8P704_XANCP/11-139 ARQLRLLSDALDSGRLGPVRRLVNTLAPA.EIGNLLESLPPGKREVVWGLVD.PEDDGEVLLHVGDEVRES..LLADMDPDEIVAAVE.DLDIDDLANLVEDLPDTVIDEVLKSM.DRENRERLEQVLSYPEDTA
Q8ZCW9_YERPE/50-178 QEERENLSDEQLQDQTAEIKTLLDDLHAA.DLADLLEALPNDERLALWRLVK.NEKRGQTLVEVSETVWDT..LIKEMSDKDLLKAMR.TLHVDEQAYLAEYLPRNLMGRLLTSL.DPDQRARVREVIQYGRDSV
Q9A6C0_CAUCR/45-173 PEYVEMVIDAADRGDAKRLRELVGALDPA.DVADLMGFLTADYREEVIPLLD.PEALGEIISELEDNIREE..VLEATPSVTLARALE.ELDTDDAADVIDDLDDTKRFQVLAAM.GETDRAAIETTLSYEDETA
Q8A0H9_BACTN/3-133 EEYIDNVKHLIEQKDADKVKELLVDLHPA.DIAELCDDLNPEEARFVYRLLN.NETAADVLVEMDEDVRKE..FLEMIPSETIAKRFVdYMDTDDAVDLMRDLDEDKQEEILSHIeDIEQAGDIVDLLKYDENTA
Q98KU3_RHILO/28-156 SSFLAQIGAAIADRDTLTLKHEVDHLHQS.ELGDLIEALHPEQRRALVELLG.ADFDFSALTEVDEAIRME..IVDHLPNAQIAQAVQ.ELDSDDAVYILEDLEKEDQDEILSQL.PFTERIRLRRSLDYPEETA
Q92QC9_RHIME/31-159 SDFLMHVGAAIADRDTIYLRQHVAGLHAS.ELGDLIEAIQPEQRIALVLLLG.KDFDLAALTEVDEGIRLD..IVEHLPNEQIAEAIG.EMDSDDAVYILEDLDEEDQEEILAKL.PFTERVRLRRSLDYPESTA
Q8UF52_AGRT5/32-160 SDFLAMVGAAIADRDLLFLRKNVARLHES.ELGDVLESILPEQRHALVRLLG.SDFDMTALTEVDEGIRLD..IVDQMSNEQIAAGIG.ELDSDDAVYILEDLDDEDREDILSQL.PFTERVRLMRALDYPESSA
Q89JN2_BRAJA/30-158 HEFVEEIARAIEAGDSAALRACVAELHEA.DLGDLIGALEPDDRVRLVELTG.RDFDFSALNEVDESVREE..ILDELPPETVAEGVR.ELESDDAVELLETLDEAEQEEILEKL.PMRERVALERSLLYPENSA
Q9KFG8_BACHD/7-135 DQLLVLMIKYLKDSKRGALQQMLDELHPY.DVAQLYRSLPDKHHHKFLTFLT.PDQIADLIQELDSDMQIE..ILHRLGIERSSKVMN.LMDNDDLADLLNELSVERIQEFLDAM.KDDESEKVQSLMGYDPETA
O34442_BACSU/8-136 DELILRIIILLRDGKIRDFRSVIDELQPY.DMAFIFKEMPEKHRARYLSYLT.VDDITDMIGELEREFQLV..VLNKVGKTKATLAMN.KMDNDDLAQLLEEMDEELKEQLLSSM.EASESKAVQLLMNYPADSA
Q9FBK4_STRCO/155-283 WSGVSGFSVEEQGQGAENLLATFEQLRPA.DLANVLHHLSAKRRAEVAAALD.DDRLADVLEELPEDDQIE..ILGKLKEERAADVLE.AMDPDDAADLLGELPEADKERLLSLM.QPEDAADMRRLMAYEEHTA
O86315_MYCTU/159-287 VAGLTPSALAMPGQDVAQLLDQFEGWKAV.DVADAIRGLPPKRRHEVFKALH.DKRLADVLQELPELDQAE..VLSQLGTERAADVLE.EMDPDDAADLLAVLNPTEAELLLTRM.DPGDSGQVRRLLTHSPDTA
Q8NRC7_CORGL/160-288 HIHGITAGGVGESNHTAELIAGFEDMRPA.DVAKQLYQLPTAQRTEVTEELD.DEKLADILQELSEDRQAE..LIEELDIERAADILE.EMDPDDAADLLGELPDDKADVLLDLM.DPEESAPVRRLMDFSPDTV
Q97L78_CLOAB/2-130 WNDVESLEMVNDNLKLTVPYQKLSTMHPA.DLADIIEDMDFNYRKKVFESLD.ENLAADILEEIDPDIQAD..ILESLSDDKKSEVLD.SMPIDEIADILDEVDEETAEKILLNM.EKEDAEEVRALMGYGEETV
Q8XKS1_CLOPE/162-290 WEDVESLEMINDNLKLAIPYKKLQKLHPA.DLADILEELDAINRKKVFDSLD.EDLAADTLEEIEPEVQSS..IIKGLSHSKTAELFE.NIPNDEIADIIDELDEEEREKVLIAL.ENEDAEEVKELMGYSDESV
Q8XL02_CLOPE/7-129 KEKLKDILAKYPSNKFDSLDDI----HPA.DIVDLLEE--NEENIKLIKKLP.ENMIADIIDFAKDDDKVN..ILKSLPEEKKKKVLN.LIASDELTDLMASLNREETSKLLSSM.PVQDAKDLRKLLTYAPDTA
Q9K7Y3_BACHD/10-138 EEYTFYLHMYLKEQEREKFRDDFLALHPI.DQVEIFSELNVQKRKRVYEWIG.PKEFAPIFRGMERNQQKQ..IVTELKESYTIKMFE.EMAPDDMTDFFEEIPNHLTGYFLDRM.DEQEAYAIKRLMSYEKKTA
Q99V82_STAAM/15-145 LYDETLLDQYLENDDIDQFRDEFLALHTY.EQSEYFEDTTDENRQKIFQYLS.PEEVANFFDQLDIDDDEY.eLLFDKMNATYASHILeEMSYDNAVDILNELTKPKVASLLTLM.NKDDANEIKALLHYDEDTA
Q8CPS5_STAEP/15-145 VYDKELFDRLLDQNDIDEFRKEFLELHNY.EQSEYFEDTDDENRQKIFEFLS.PKEVANFFDQLDFDDDDYesLFDNMDATYASHVLE.EMSYDNAVDILNELSKPKVASLLTLM.NKDKANEIKALLHYEEDTA
Q8ERS6_OCEIH/15-143 QVHIEKVNTALQEGEIEVFRESFLDIHPY.DQAMFFNQQDEEARGQIYTYLS.PEEMSEILINIDLEDVTA..FFEEMDPRYAAMILA.EMPTDDAVDVLNELDKEKVASYLTIM.DQESANEIKQLLHYEEKTA
Q98MM2_RHILO/1-125 MNDFS----PVADDEAVAIARILANDHVA.DVVEALNHESRETATDLLCAVP.FERLVEIFDQPELDGAPE..LADALPRAKASKLLT.AMSVDRAADILRELDEPARSELLGAL.APPLRATLLSILGYPEGSA
Q8UGN7_AGRT5/7-128 SQRASKAARLLRSGNA-------GSTTIA.ERVEHLNTLDTDAAVAALLAMP.QAKAVAILDRPELHDAAA..IIAGIPLEQAARFVN.LMSDDRVADVMAEMEEEPRAKLFARL.DRTTALSIKHLMGYPPRTA
Q8PFA5_XANAC/1-125 MYDEI----LRLAEGADALTAPLAELNTA.DAVEYLNTLDRDEAAQVLAALP.LLRAVKLLEQPELRDAST..LVASLPAEQAASLLG.QMADDRATDIFHGLDAEQRQPLLWLL.SAEARLSIQALMRYPPNTA
Q8FVG5_BRUSU/12-135 AEVLN-----VADLPAAAIASRITDMRTG.DAVEIVNELDADDAVAVIAQLS.HDDAIRLLDQPELHRAAE..IVAALQPGLASLLLD.GMSADRATDVFQELEDVDRARLFPIL.APETKAALKKLMGYPPNTA
O06312_MYCTU/7-136 ENSTLDIRHVIGIGTPKAVDLWLDVVTELpDRARELGSLSKAELGKLGPLLD.GTNAVELFESIDDKLAAE..ALHAMDPSLAATFLE.ALDSDHAANILREFKEPKREALLTLL.PLERAMVLRGLLSWPEDCA
Q9PRD6_UREPA/19-147 NFLTQNILKTYEHKDITGLKKLLKSKRID.KIVESLETINDTQIILFVLVATkDGICGDIFKYLNTELKSK..IINDASLQQLRIILF.ELYNDDVIILKNDFPMYTKKILLSL-.DSQQRAAIKQLSEFDEDEA
Q8EHS2_SHEON/11-139 KQIVVAIQNILEQRNTAGITALAKERHPA.DIAAVLGSFTQPQQLQFLQLVP.AKFAADLFRYLSDELQAA..LVQQLDKTTLSSLLL.TMAADERADLYNLLEPEQQKLLLPVL.AQAKREDMRTLAAYDKTKV
Q92H85_RICCN/19-147 AEIFDQINDLIEDHNYDAAASRLAKLHYA.DLADFLDNLNNKTYKIIIPLLQ.DEIKPETLVSLNAYSKPL..IIETLGIKKSAELIN.KLVIEDAIEVVIDLDDDIKDLILSNL.TKEKKHQITVGCTYPENTV
O84197_CHLTR/14-143 FKLEEAFDTLTAGEHSQDLTSIVSVYNPI.DLAYAVSCLPSDSRSILYKNLDsIASKIAFIINTDSASRWA..IFRNLSDGEICALIE.QMPPDEAIWVLDDIPDRRYRRILDLI.DVKKALKIRDLQKHGRNTA
Q9KLC8_VIBCH/8-137 SQQIELIATAEESEQTHLLGEMVENGLDEgSIALILEAFPVEQRVRLWRSLP.LEMHIDVLTEMRAEVRIS..VINALSEIELKLTLA.KLDNLSLIEWEDSLPDDIISEALSLI.NRDELELYDQANEFADDEI
Q8D5W6_VIBVU/8-137 PLLIEQIAQAEDAEQIVLLNDSIEHGLESgSIALILESQPVDDRVRLWRALP.LEMHIDVLTDMRADARYS..VINALSEIELKLTLA.KLDNLSLIEWADSLPEEIINEALSLI.QKDELELFDLANKYGDDEL
Q87GS5_VIBPA/8-137 STLIQQIGQAEESDQVATLNESIEAGLEPgAVALILEAFPIEDRVRLWRALP.LELHIDVLTEMRADVRFS..IINALSEVELKLTLA.KLDNLSLIEWADSLPESIINEALALI.EKDELELYDQANEYEDDEL
Q8EGN5_SHEON/17-145 GQVVQQLTEVEGEEQAEVFSEILNEAEPG.TIALALESLPLDERYERWQQVE.FSERVTVLSLMRADPRMG..ILKQMPDNEVDLLFA.QLSPEDLIEWSDYLPESFTDRALAQM.GERQRQRFELYDQYSENEI
O68316_VIBCH/17-133 KQLNEFARKLAHSSRRDKWVEKLFKLTEQ.EIHFVLQQLTGEQLAELILLLS.PPRAGHLLCVMDSNALN-..LGLAYANPRVVEKALrSLNEDELHGVFNMMNPINAERYRER-.-----------LRWGEESV