EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03444 alignment
(5 sequences with 178 aa)


P95951_SULSO/3-175 NLSPTQREILLALTDLYNRQK-RMIKSKEVADIIGKDEGTVRNIILSLKVLGLVESKPGPNGGYMPTLKAYEIINNPTLTPI----LDKLNLYKGMIETDIKVENIEIIDITNPSANRVLLKVEGDLRKLKIGDAVRLGPTPYSRLVIEGLILHLDENSKEIVVDVKRMISIPKEKVK
Q9YDD9_AERPE/35-210 MLTSLQREVLETLVSLYERHK-RMIKSKEVAEALGKDEGTVRNVIMWLKSLGLVESRTGPAGGYMPTLKAYEVIGVQTPTLSHVTYGQVIVEKDGNQYR-YAALDMEIMGIFGSDTMKAVVTVSGNIAPIEKGDLVRVESVPVRKFALEGRVEKVSREARQLMIVISKMTVIPNIKVN
O26229_METTH/10-183 MLTSVQKEILQTLINLYRNSNGKSIKGEEIAAIMNRNPGTIRNQMQSLRSLGLVKGVPGPRGGYKPTIKAYHQLNISSTGRE----TAVPIYRDGEQIEDLSVAKIEFTSIPDPGECEAAIKLVGSIRKLDLGDRVRIGPTPVNKLVVDGVVVGRDDMDNIILLDTTAIRSIPKKTVA
O30125_ARCFU/5-178 DLTQIQKDILYALITLYKKKSGGSVKGEEIAELINRNPGTVRNQMQALRALGLVEGVPGPKGGYRPTSKAYELLSVTRPEES----VVVPVVVNGNVMEELSAEEIVLPSISNPNICQARIRIIGDIKKINPGDSVIVGPTPVNEMMVYGKVVGRDDTENTIVLDIEKIVALPKDTVG
Y1232_METJA/2-173 ELTVVQREILQELINLYREKN-RPIKGTEIALRLNRNPGTIRNQMQALRALDLVDGVPGPKGGYVPTSKAYRALGLEDEGE-----IIVPIYKDGKKVEGVKVVKIEFDTVSHEKCCSSKIHIEGDTKHFNIGDIIRVGPTYHNKIIINGKIIGRDDIHRILLIDVLGVSSIPNIKVG