EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03440 alignment
(5 sequences with 105 aa)


TOX3_BORPE/15-117 ILVLALLGMRTAQAV-APGIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYD-GTYLGQAYGGIIKDAPPGAGFIYRETFCIT
TOX2_BORPE/14-116 VLPLALLGSHVARAS-TPGIVIPPQEQITQHGGPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYD-GTYLGGEYGGVIKDGTPGGAFDLKTTFCIM
AERA_AERTR/8-106 GLSLIISATLAAQTN-AAEPIYPDQLRLFSLG--EDVCGTDYRPINREEAQS---VRNNIVAMMGQWQISGLANNWVILGPGYNGEIKPGKASTTWCYPTRPATA
AER3_AERHY/8-106 GLSLIISGLLMAQAQ-AAEPVYPDQLRLFSLG--QEVCGDKYRPVNREEAQS---VKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGSASSTWCYPTNPATG
AERA_AERSA/9-108 NLANLASSLMLAQVLGWHEPVYPDQVKWAGLG--TGVCASGYRPLTRDEAMS---IKGNLVSRMGQWQITGLADRWVIMGPGYNGEIKQGTAGETWCYPNSPVSG