EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03427 alignment
(2 sequences with 61 aa)


CHI1_RHINI/330-390 ITTTSLATASSALFPLLYAGRSCSSQSKVSCTSTGSYTICNYGKWVTAPCPPGVICLSSAQ
CHI1_RHIOL/338-398 TTTTAAPTATSAPGSCPVANQSCSTQNQYACTADGKYAVCDHGKWVVSSCPSGTVCIPTTD