EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03423 alignment
(9 sequences with 87 aa)


Q45574_BACSP/869-953 YYKT--SWTNPHIHYSLNQEAWTTLPGVPLNSSEYEGYAKITIETEEGSQLRAAFNNGRGQWDNNQGRDYVFHSGINTLADGVIVRG
P96992_STRLI/156-241 YSTRTLGWTTANIHYRPAGGSWTAVPGVGMR-AACAGWWKKDVDLGAATSLTAAFNNGNGVWDNNKGADYTLPAGVTTVADNTVTAD
P96992_STRLI/48-133 YYTKTKNWDRYNLHYAPDGGSWTEVPGVAME-AACTDWVKRTVPLGSAEGLRATFNNGSGTWDNNGGENYALGTGALTVKDGVVAHS
O24781_BACSP/510-594 YYSTSKGWSDYKIHYRVGTGAWTTAPGAGMT-AACAGWVSYTVPAG-STGATAAFNNGSGTWDNNNTSNYALSGAVSTVNGGVVGHT
O24781_BACSP/611-696 FYSTNKGWSAYNIHYRVGTGAWTTAPGSAMT-AACTGWMTASIPLGGASGITAAFNNGAGTWDNNAGADYSVGSGYRQVKDGVVSTG
Q03658_9BACT/1190-1274 YYKN--GFDTPYVHYRPEGGTWTNAPGIKMDKSEIAGYSKITLDIGRADRVEVAFNDGRGAWDSDNERNYLFVVGNNTYEPGINGAP
Q03658_9BACT/1086-1170 YYQN--GFDTPYVHYRPEGGNWTNAPGLKMEDSEFASYSRLTLDIGEANRAEVAFNNGRGLWDSDNENNYFFNIGDNTYIPGKNGSA
Q03658_9BACT/983-1067 YYKK--GFDTPYMHYRPEGGEWTIVPGIRMEESEIAGYSKLTVDIREASKLEVAFNNGRGAWDSDQENNYLFEPGVHTYIPSHEGRG
AMYB_PAEPO/464-548 YYKK--GFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYSFSTGTSTYTPGNSGNA