EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03414 alignment
(6 sequences with 341 aa)


BGAT_HUMAN/17-353 LRPMILFLIMLVLVLFGYGVLSPRSLMPGSLeRGFCM--AVRE-PDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVA-FLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
O77563_PIG/27-363 FYSNVFSLTPGWQSKESQSPEPQQLQESSLQpESLPLSECDCH-LDTCRIPEVPRLIYPKAQVLKPTRVDVLVMTPWFAPIIWDGTFDSAVLDAQF--RNTTIGLTVFAIKKYVV-FLKLFLETAEKYFMVGHRVNYYIFTDRPADVPQVPLGEGRQVVVLEVRNYSRWQDISMHRMEMIRNFSQQRFLHEVDYLVCVDVDMKFSDHVGVEILAPLFGTLHPGFYAAPRQSFTYERRPLSQAYIPRDEGDFYYAGGFFGGSVPEVQRLTTACHQAMVADKAKGIEAVWHDESHLNRYLLYHKPSKVLSPEYLWDEHMLQRPPFLRKLRYVAVPKNHAEIRN
Q95158_CANFA/10-347 LGFSLLSGIALWSLWIYMETWLPFSYVPYYL.PCPEIFNMKLQYKGEKPFQPVTRSPHPQPKLLEQRPTELLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGLTVFAVGKYTR-FVQHFLESAEQFFMQGYQVYYYIFTNDPAGIPRVPLGPGRLLSIIPIQRHSRWEEISTRRMETISRHIAQRAHREVDYLFCVDVDMVFRNPWGPETLGDLVAAIHPGYYAVPRQQFPYERRHISTAFVAENEGDFYYGGAVFGGRVAKVYEFTTGCHMAILADKANGIMAAWQEESHLNRRFISHKPSKVLSPEYLWDDRK-PQPPSLKLIRFSTLDKATSWLRS
GGTA1_MOUSE/62-392 RIPEVGENRWQKDWWFPSWFKNGTH------.-SYQEDNVEGRREKGRNGDRI-EEPQLWDWFNPKNRPDVLTVTPWKAPIVWEGTYDTALLEKYYATQKLTVGLTVFAVGKYIEHYLEDFLESADMYFMVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGEGDFYYHAAIFGGTPTHILNLTRECFKGILQDKKHDIEAQWHDESHLNKYFLFNKPTKILSPEYCWDYQI-GLPSDIKSVKVAWQTKEYNLVRN
Q28855_9PRIM/39-374 KNPEVDDSSAQKDWWFPGWFNNGIHNYQQ--.EEEDTDKEKGREEEQKKEDDT-TELRLWDWFNPKKRPEVMTVTQWKAPVVWEGTYNKAILENYYAKQKITVGLTVFAIGRYIEHYLEEFVTSANRYFMVGHKVIFYVMVDDVSKAPFIELGPLRSFKVFEVKPEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQDHFGVETLGQSVAQLQAWWYKADPDDFTYERRKESAAYIPFGQGDFYYHAAIFGGTPIQVLNITQECFKGILLDKKNDIEAEWHDESHLNKYFLLNKPSKILSPEYCWDYHI-GLPSDIKTVKLSWQTKEYNLVRK
GGTA1_BOVIN/39-366 RNPEVGGSSIQKGWWLPRWFNNGYH------.----EEDGDINEEKEQRNEDE-SKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHI-GLPADIKLVKMSWQTKEYNVVRN