EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03382 alignment
(5 sequences with 161 aa)


Q9RG11_MYCML/73-230 KGIPKTVKKVSSKLPEKITSLYGAFSYRNPN-D-TDVTGFEKWDTKNITDMSYVFSNNSIVNADLSSWDTSKVTNMNGMFKNAAKFNNGGKPLNWKTYNVEMMEEMFDGATSFDQDLKDWKVDKVKKNKNFSRGSGIFGFENKRPKWT-LTEINDPIEKKI
Q9RG02_MYCCA/71-229 KGIPKTVKKVSSSLPPEITSLYGAFSYRNTD-D-VIVTGFERWDTKNITDMSYVFSNNSIVDIDLSFWDTSKVTNMNGMFKNAVKFNNGGKPLKWTTSNVETMESMFDGATNFDQNLKDWKVDRVKNNKNFSRGSIFSNYENKKPKWKGVIEINDPIIKKP
Q9RAJ0_9MOLU/71-230 KQIPPKIKKVSGQLPTEIKSLYGAFSNRNIN-NGVKVTGFETWDTSNITDMSYVFSNNHIFDADISKWKTNNVTNMNGMFKNATQFNNGGKSLEWDTSNVTSMDSMFEGATNFSQSLKNWRVEKVTKNKNFSRGSGIFGYSNKKPNWNSITEINDPIEKKV
Q9RFZ9_MYCCA/75-233 RQIPQNVKKVPNELPVEIESLFGAFANRF--EHHENVMGFENWNTSKIKDMSYVFSNNHIFNGDLSNWNTENVENMQGMFKNAIKFDNSGKPLSWRTDKVTSMESMFDGAKSFGQNLMNWKVDKVIKNRNFSRGSGFFEENNKKPKWINIKEENDPIDKPK
Q9RFZ0_MYCMS/74-233 KQIPYYVKKVPDKLPDEIQSLYRAFAHRYKDQNHPTVTGFEKWDTSKIKNMSYVFYDNQLIDADLSEWKTSNVTNMDGMFKNAIKFNNKEKPLKWNTEKVESMESMFDGAESFKQNLKDWKVDKVTKNKNFSRASGIFEHIDKKPSWK-ITEHNDPIIKKP