EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03350 alignment
(5 sequences with 175 aa)


Y189_HELPY/2-174 LEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLNTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASE-ITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFS-QN
YREP_BUCTC/1-162 MKNIIEKMIYISRWLIFPIYLGLSFCLILLTLKFFQLVFFIFPEIFFISESGLILVILSLIDIVLVGGLLVMVMFSGYENFISKMN-IEGDK-LGWMGTMDVNSIKNKVSSAIVAISSVHLLRVFMETEKVSN----------EKIVWYVIIHLTFVVSAGGMAYIDRLNKS-NI
YREP_BUCTS/1-164 MEKRIANIIYSSRWLMFPVYIGLAFGFVLLTVKFFQQIICVIPEILTMSESGLVLIVLSLIDIALVGGLLVMVMFSGYENFIAKMETTENKKRLSWMGTMDVNSIKNKVASSIVAISSVHLLRLFMDADKISD----------NKIMWCVVIHLTFVLSAFGMAYIDKMSKK-HY
YQHA_ECOLI/1-164 MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPD----------NKLMWYVIIHLTFVLSAFVMGYLDRLTRH-NH
Y507_HAEIN/16-180 QSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINVNDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVLKVKLSMSIIGISSIHMLQTFVNASNMPE----------KTMMWQLLLHLGFLVSAIALAYTDKILYSTSH