EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03313 alignment
(9 sequences with 289 aa)


Q9RXD7_DEIRA/20-291 RSLTMTLEELMNAPAPASRWVLERDCAETGLDPADIRAEMLRRIGEMRSSVERGLQSDARSITGMVGWNAKGLWD---APDVLGAP-L--------LKRVQAYAMAVNEENARMGRIVAAPTAGSAGTIPGALLGVADHLGLSD--.-EQLVDPMILAAGVGKAISKRMFISGAAGGCQAEIGSSAAMAAAAVVELLGGTPRAAVHAASLALMNTIGLVCDPVGGYVEVPCVSRNAFFAVHAVSAAQLALAQL-ESFIPPDEVLGAMASVGRLMPAALRETAEGGLAQT
SDHA_BACSU/3-276 RNVKELIEITKEKQILISDVMIAQEMEVTEKTKEDIFQQMDHNLSVMEAAVQKGLEG-VTSQTGLTGGDAVKLQAYIRSGKSLSGP-L--------ILDAVSKAVATNEVNAAMGTICATPTAGSAGVVPGTLFAVKEKLNPTR--.-EQMIRFLFTAGAFGFVVANNASISGAAGGCQAEVGSASGMAAAAIVEMAGGTPEQSAEAMAITLKNMLGLVCDPVAGLVEVPCVKRNAMGASNAMIAADMALAGI-TSRIPCDEVIDAMYKIGQTMPTALRETGQGGLAAT
SDHA_PEPAS/3-277 NTAREIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVTEYKMIDGFAKRTYEYANSGKSIVGD-F--------LAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPAMLVAATEKYNFDR--.-TTIQNGFLTSIGIGQVITKYATFAGAEGGCQAECGSASAMAAAALVEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALAGV-ESLVPFDEVVIAMGEVGNSMIEALRETGLGGLAGS
SDHL_HELPY/174-452 SSAKELLELCQKHQKSIAEIVRLRE--NALKNHP--DATMVKIYHAMLECYDNGANS----KERYLPGSLKVTRLAPSIKTRLEKHPTSGKDPLALIDYISLYARAIAEENASGGKVVTAPTNGACAVVPSVLLYAKNHLFENLS-.QKAINDFLLTSAAIGYLYKKNASLSGAEAGCQAEIGVASSMAAGGLAHLCQATTQQVLIASEIAMEHHLGLTCDPVGGLVQIPCIERNVLGAIKAISASKLALEDEYKPKVSLDEVIATMYATGKDMNEKYKETSLGGLAKT
SDHM_ECOLI/172-450 SSAADLQKHCQETGLSLSGLMMKNE--LALHSKEELEQHLANVWEVMRGGIERGIS-----TEGVLPGKLRVPRRAAALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYYDKFIREVN--.ANSLARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGASPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSEPRVCLDKVIETMYETGKDMNAKYRETSRGGLAMK
SDHL_ECOLI/172-450 KSATELLAYCNETGYSLSGLAMQNE--LALHSKKEIDEYFAHVWQTMQACIDRGMN-----TEGVLPGPLRVPRRASALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYYDHFIESVS--.PDIYTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGGSPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALRRTSAPRVSLDKVIETMYETGKDMNAKYRETSRGGLAIK
SDHL_HAEIN/173-451 KNAEDILKHCSDNGLMLSTVMLENE--IALNGKEAVSAHLENVWKTMQACIEHGIH-----TEGILPGPLRVPRRAASLYRALQANTNLSNDPMRVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYYEKFISPLT--.PEIIERYLLAAGMIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAEILGGNPLQVCIAAEIAMEHNLGLTCDPVGGQVQVPCIERNAIASVKAINASRMALRRTTNPRVTLDKVIETMYETGKDMNAKYRETSQGGLAVK
SDHL_STRCO/176-451 RTGDELLRLARETGLSISALMLENE--RAWRDEDEIREGLLEIWRVMRACVDRGMT-----REGILPGGLKVRRRAANTARKLRSEGDPQ---ALAMEWITLYAMAVNEENAAGGRVVTAPTNGAAGIIPAVLHYYMNFVP-GA-D.EDGVVRFLLAAGAIGMLFKENASISGAEVGCQGEVGSACSMAAGALAEVLGGSPEQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNGMAAVKAVTAARMAMRGDGSHKVSLDKVIKTMKETGADMSVKYKETARGGLAVN
SDHL_MYCTU/173-453 VSAQELLDICDRLDVSISEAALRNE--TCCRTENEVRAALLHLRDVMVECEQRSIA-----REGLLPGGLRVRRRAKVWYDRLNAE-DPTRKPEFAEDWVNLVALAVNEENASGGRVVTAPTNGAAGIVPAVLHYAIHYTSAGAGDpDDVTVRFLLTAGAIGSLFKERASISGAEVGCQGEVGSAAAMAAAGLAEILGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERNAISAGKAINAARMALRGDGIHRVTLDQVIDTMRATGADMHTKYKETSAGGLAIN