EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03301 alignment
(5 sequences with 354 aa)


O77457_ANOGA/11-358 DSVQGGHHLGSEA-GMLYGEYLMLDKVLSAQRMLSVEGKKPVHDEHLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEESR-TLEILKRLNRIVMILKLLVDQVPILETMTPLDFMDFRDYLSPASGFQSLQFRLLENKLGVKSEHRVKYNQK-YTEVFASDPGAIERIGTTETEPSLADLVQKWLERTPGLEQDGFN..FWGKFQESVEQLLAEQEASAMSEEHENVREYRL-MDIDKRREVYKSIFDAQVHDALVARGERRFTHKALQGAIMITFYRDEPRFSQPHQLLMLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFL
T23O_RAT/26-372 DGAQTGVNRASKG-GLIYGDYLQLEKILNAQELQSEIKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVMTRMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFEGDYN--ELLLKSEQEQTLLQLVEAWLERTPGLEPHGFN..FWGKFEKNILKGLEEEFLKIQAKKDSEEKEEQM-AEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYYYLRSTVSDRYKVFVDLFNLSSYL
T23O_CAEEL/22-371 EECQQGVNKVEMGFGQTYSEYLQLDKILTAQRLKSEADGQRVDDEHLFIVIHQAHELWFKQIIFDLDNVRKLLNNTIVDETK-TLKIVSGLDRMTKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRVLENKLGVRQERRIKYNAQHYKNVFNDTDL--KTLNVTEEEKSLLTLIESWLERTPGLKSTSEDegFWIKYEKSVNKYLADLAKQAADPSNTEEIAKQLTAEYHKTADAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDIDSLFTKWRYNHVLLVQRMLGA-KQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWL
Q9RYH4_DEIRA/16-287 HSAEQAHRDFSRS--LSYGDYLHLDELRSAHQPITD-----AHDEHLFIAIHHVSEVWLSLIVRELQAAMRLLDAGITDAPL------KMLTRVVRAQEQLTAAWDVLKTMTPADYLQFRGAFGQASGFQSQNYRMVEFLLGNRNS-----------T-----------LLRPHEHRADLHRPLAAALHAP--------..-------SVYDLTLRLLAARGLPVPAEVLQRDYAQPYQTNEAVLASWLS---------------------------VYCDTETYWDLYELAEKLVDVEDNFRRWRFNHLTTVERTIGF-KRGSGGTSGVGYLRG--ALDVVLFPELWDVRTQL
Q9X8R3_STRCO/1-271 MSHDAPNLDFEGS--TPYEDYVKADVLTHLQHTLSD-----DPGEMVFLVTTQVMELWFTVIVHEWETAARALREDRTPVAT------DALKRSVRELEALNASWTPLAGLTPAQFNSYRSALGEGSGFQSAMYRRLEFLLGDKSAS----------------------MLVPHRGAPRVHAELEKALHEP--------..-------SLYDEVVRLLARRGYDIPDAVLQRDLTRKYEAAPEVEAAWTA---------------------------VYSGDQNG-ELARLGEALTDVAELVWRWRNDHLVATRRAMGS-KTGTGGSAGVAWLEK--RARNNVFPELWTARSYV