EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03296 alignment
(3 sequences with 481 aa)


Q9Q944_9POXV/1-470 MNAR---------IADLLYNYLGRPPSLSEYHMLKLQHRNIQKIIAFNKDIFISLIKKNKKKFFSDIDLTSSEIKTSVLSYFSKQRDTYSIGKLYTIIELQTILVSTYTDVLGVLTLKGPDMFPSSTRYDIKSIKQIATSALHAMNVAVIS-DKVMGRHNVSPLVSNVNALMEEYLRRHNKNCICYGSYSLYLLNPEVKYGDIDILQTNSRTFLIDLAFLIKFITGSNVVLLKVPYLKNYMVLKDKDDNHIIDSFNIRQETMQVIPKVLIDNIYIVDPALQLMSMFKMFSQIDRLEDLARNPEKLTVRLATLMEYVRVKYGIILNGESNHMPMKGVLDKDKRIIDVDTSGYNFSFKKCYVYLDESSLSSDILDLNADDA-VDFENVSNSAYLINGDVLYTYFSNTILLSDPDTIHEISNKAMSAHILIYQILTGNDIRQPLSDLVNSLMYNEKVLIHEVIPRDKKTGKHGIVDIEKDIITH
PAP1_VACCC/1-479 MNRNPDQNTFPNITLKIIETYLGRVPSVNEYHMLKLQARNIQKITVFNKDIFVSLVKKNKKRFFSDVDTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAIIDKAKVMGRHNVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDY-FSFKKCLVYLDENVLSSDILDLNADTS-CDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Q98199_MCV1/1-470 MNGA---------QFELLREYLGRPPTLNQYFIFKPQARAIQRIMRFDTDVFFALIKKNKKRFFARIGGSASEINARVLSYFVKQRATTKVGRILSIIELQSVLVNSYTEIMGVLTLPAPPVYNSVVRLHYCSMERLAEEVLWSYNVAFRS-GKVMGRHCVSNLVVHVNKLMSEYLRRHNRTAICYGSYSLHLLNSRIEYGDIDILQTNARLFLINLAFLIYFITGRNVLLLKVPYLKSYIVMQDEEGRHIIDSFNIRQGTMQNVPKVLVDNIYIIDPVVQLMNTLKMLSQIDRLEDLGERMAKMRLRLATLLEYARYHHCVSFGG-GARLRLHMRLDAGARIVLVDTRCYGLGYRECRCYLDEARLLQDISKLNADAAVVDFEAVSNSVFLIHQGIMYTYFSNTVLLRSEDAIHDVSERAVCAHITLYHLLVGCNYQELLADLLNSLVSREKCPVVGVVARDKKVGRHGVIDIEKDVITH