EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03295 alignment
(4 sequences with 109 aa)


VLTF2_FOWPV/43-151 LEIRKDKDNCWFCKQDMNTYNPYFIETLYGDHIGVFCSKICRDSFANMIKSVIALREEPKISLLPLELYEKPEEVLEVINDLRHKEGIYGSCILESDKNIIKLTLRCHC
O11355_MCV1/1-108 MQVNSERARCWFCSQAVGAAA-WAIETLHGHAVGSFCSRICRDSFASTVRTHVALREEPKVTLLPLVFFQHPEKVLELIRSLRSREGIYGTCFFDERAGAVTLTLRSLH
Q9Q8L1_9POXV/43-149 IPVNTNTVTCWFCKQDLIVVP-LRVETLKG-QVGYFCSRICRDSFAAMIKTHVALREEPKITLLPLVFYNKPEEVINIINSLRNKDGVYGSCFYKENDQSVQISLRSLL
VLTF2_VARV/43-150 IKTNSVIDKCWFCNQDLVFRP-ISIETFKGGEVGYFCSKICRDSLASMVKSHVALREEPKISLLPLVFYEDKEKVINTINLLRDKDGVYGSCYFKENSQIIDISLRSLL