EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03284 alignment
(3 sequences with 162 aa)


O69752_PSEAE/1-162 MNGQRYRETPLDIERLRRLNRATVERYMAMKGAERLQRHSLFVEDGCAGNWTTESGEPLVFRGHESLRRLAEWLERCFPDWEWHNVRIFEAEDPNHFWVECDGRGKALVPGYPQGYCENHYIHSFELENGRIKRNREFMNPIQKLRALGIAVPQIKRDGIPT
PHZB_PSEFL/1-162 MPDSTVQQPITDDTELRRKNRATVEQYMRTKGQDRLRRHELFTEDGSGGLWTTDTGAPIVISGKAKLAEHAVWSLKCFPDWEWYNVKVFETDDPNHIWVECDGHGKILFPGYPEGYYENHFLHSFELQDGKVKRNREFMNVFQQLRALGIPVPHIKREGIPA
PHZA_PSEFL/1-162 MPGSLSSGGFNDHLELRRKNRATVDQYMRTNGEDRLRRHELFTPDGSGGSWNTETGEPLVFKGHAKLAALGVWLHQCFPDWQWHNVRVFETDNPNHFWVESDGRGTTRVPGYPEGYCENHYIHSFELDNGKITQNREFMNPFEQLRALGIPVPKIKREGIPA