EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03274 alignment
(4 sequences with 267 aa)


P89873_FOAMV/29-285 ENAGEGELTIAEEPEENPRRPRRYTKREVKC------VSYH-AYKEIEDKHPQHIKLQDWIPTPEEMIAQKVQNQDLGTILSFDVTCLKSITSLGRNDPGDDPSIMSHVLPVVTPWPMSQDHYAPTLFGILDRYYQGYLKSPATYQTWKFTCQVDPSGKRFMETQFWVP--PL-GQVNIQFYKNYQILTCCQAVDPFANIFHGTDEEMFDIDSGPDVWCSPSLCFKVIYEGAMGQKQEQKTWLCRLGHGHRMGACDYRKVDLYAMRQ
BEL1_FOAMV/1-205 LLLRNLK--------ENPRRPRRYTKREVKC------VSYH-AYKEIEDKHPQHIKLQDWIPTPEEMSKS---------------LCKRLIL-CGLYSAEKASEILR--MPFTVSWEQSDTDPDCFIVSYTCIFCDAVIHDPMPIR-W------DP------EVGIWVKYKPLRGIVGSAVFIMHKHQRNCSLVKPSTSCSEGPK---------PRPRHDPVLRCD-MFEKHHKPRQKRP----RR-RSIDNESCAS-SSDTMVNEP
BEL1_SFV3L/28-242 LDMDQFEPTEG--PDSNPGAEKIYLQLQVAP-GDPSEKTYKFGYEDKEAQNP-DLKMRNWVPDPEKMSKW---------------ACARLIL-CGLYNAKKAKELLK--MDYDIHWEQSKEDSQYFEIEYHCKMCMTVIHEPMPVS-Y------DK------KTGLWIKMGPLRGDIGSVVHTCRRHYERCMSALPSS--GEPLK---------PRVRANPVRRYR-EKSLIVADRPKRS----RWGVAPREQPNTS-SGDAMALMP
BEL1_SFV1/30-245 LELDEMEPKVL--CGENPGDEKLKKQVIKTPPMHPSTVTWHFGYKQKEDQQD-NIKMRDWVPDPSKMSKS---------------TCKRLIL-LGLYQACKAQEIIK--MDYDVHWEKSVVNEQYFEVEYNCKMCRTVLHEPMPIM-Y------DP------ETELWVKPGRLRGPLGSAVYTLKKHYERCLLTLPSL--KGTRL---------PKRRCNPSRRYE-TFREHPPTRKRRS----KEGIPTDQQPSTS-NGDPMALLS