EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03268 alignment
(7 sequences with 366 aa)


O16244_CAEEL/60-411 LLGPFRFLVKASLLDCSTKS--------KCCSVFTCLLGVVMVVVTLIRISFLMEAVGAPLELGWGEGIFFGYPGLTGFVFSLCLFGWTKNGLIPKFCKRLVRVRMLRQAANSK-LDKFRILHGLALGFSIPWFVAMMSWIIYNFVH-GKVYYGGPEQS-IAKRIFLIISNFYVWFISTVCLAIYIFISAALNREVSYFNEELKKAKEEKTLRNIGVLEKFDFRQNQILEMILFAHESLSSLGGFVPLFMYWGLANGVYLTS---FVYDVPLLYAIIVGFNLASIIFYNVFVMFPAIILQEHLKTTTRILINNDEFECSKDPIVYQTYRIMIDRFQKVNTNISIIASLPITVQTFAACSFVAPNLG
Q9XVJ4_CAEEL/45-398 LLGPFRFLIKLTLLDCSTKS--------KCCGLLTTLIAIGIIVALLARVGLLMETDGKPLSFAWAECNFFGFPAIFPALSAVSILSWTKSLFFPNFVKKLIRLRNLRLEPNQK-LDSYGRIHVVALIFSIPWLIAMMSWILYNYVENATIYFGATEESKVIYRVALIISNFYIWFISTVCLAFFVLVFTSINREVSHFNQELEKSKNEKTLKSIGILEKFDFRQNEILELILFANQSLSSFGSVTPLFLFYGLINGVYLTS---FFDDLPTLYKVILGLNLAAIIIYNFIILSTACALQEHLATSTRILINHYEFECSKDSTVYQTYRLMVDRFQKVDTRMYVVSAIPITRSTFAAASFIVPNMG
O44618_CAEEL/25-384 LLGFLKYTTKLTGLDCTACAAAKNGNGSKICGFLARLFSIVVILSMLYRAITFLGEEGKLLTFNWSESNSFGFMGLHAFVCSLCVMGWTANARFPNHIKRLNEVRVLRVEPNEE-IDDYSGFRKKAFFFSLPWLATLVSTALFNALQ-EKILFSGAVVP-AYKYSLFPALAFIVWMTTSTCLAFYALFQFSMVRETEYFNKELQKASEDKKLKDPTVIADFSYRQRELLKLVNETNEFLQSYAKVAPLFCFFSIINAIFNLS---FFSFVPVPYAIMLVFLLACIIGMIILSLLPAAKVQDQIVATSKILMESEDFENAENQKVYQTYRLMVDRSLKSETRIFVVNAFGINSNNLNIAMFVIPNLG
O16245_CAEEL/33-364 FLGPYSIILKFSGLDCSRVSQSKTDNVSRLKSWITQLVPLLIIALTVLRCYTLFQLEARSMSFQWAECSMFAYMGVQSVEYAYSLYSWSKKHFISSHLESLENIRLLRLKDNKN-IDNCLKSHIKIFIWSCLWIVGVMAHAICSSIN-EKIFLSFNDIS--------------------------------LKREIEYFNVELEEAQTTKTLHKSDALQRFCHRQKELIGLVRKANKHLGDYTGTTPIACFNACVNGTYMWFGFHDFPMDSSISSIILKYNIFAVLFITFFSLRPASNVQFQLADTARILMENEEFGKTKDSEVVNTYHTMIDRSLRHTARLRVHGGIPIYPKTVNIAMFFIPMIV
O16246_CAEEL/33-393 LLGPFRKIIKITGLDCSLIARAEFNPSLRIKSILTRIVALVVVAIVFFRMAIYSKAEGACLSLAWAEGNMFQFMALQTIVCALCLFGWTKNSFISKHLGRLEKVRSLRIKENIE-MDNYSNTHRKAFIWSGFYIAAIMSHAIMSSIA-QKILIANKTVI-APLYIAMVFINLLSCFIVAICLIYYFLVNLSLSREIRYFNTELEDAKQGRRLQISGVLSDFCHRQAELIRVVRETNESLQSYATVAPLFAFNSLINAVFIASG--FSSSLPPVVFGVLLFDLFAVIGLTFFTLRPASNVQYDLAQTARILMDSEEFEGSQDVEVFKAYQVMINRSLKHTAHIRVVGAIPIYPTSAHFAFLLIPNLG
O18140_CAEEL/17-370 IFGFFRYLLRVSPYNCSRSN--------PIRFLFVIFSLLSFLALIFRAYWMFFQISSTILSLGWAERNLYAFISMESFSCVIALYRMTTVGSLEKFEQSLANLKRMRVTGYHESHDEYGKLRLKIFLLKTPIPVFFIATAIYLVVK-QKIIVDTTTHN-NWYYFFDAGVMALCAYVNFLFLPIHALIQNAIAREFHVFNEELEGASKNKELLNPAIFQTFADRQIKMFEYTNALTTRLMPFMSSAPFLILTALANVTFIFTN--LGSLIDTYYYICMIGLMICCIIISSNLMYPPALVQEAMLHTSTVLMDDQYVHHSKDPQIYTTYRSMVDRSINNRTVNLVVQIFSVNRKNIERAYFVITNIV
O45459_CAEEL/19-372 IFGVYPYLLKFSPFNCEKSN--------PLRFVFMIFSFITFLAMVFRAGYMLFYLDVKALTLGFAEQNLYGFISMESFCLVIALFKITKVGRLRKVEQKLAEMREMRITSFHESHDKYWKLWIELFIFNSFNLVLFIGTAIYLLCN-RVIIVGTKTKS-SWYYYFDAPVMILCAYANFLHLPIHELIHTAFAREFRVFNDELENASKNKELLNPQTFQRFADRQIKMFECINPLTERMNRLMAFAPLFILTALTNVLYLVTN--LRSATHTLYFICMVGMLISCIIISKILLYPPALVQEAMLHTSTVLMNDQFIHHSKDPQIYSIYRTMVDRSMHNRSVNVVIRIFDVNRKNIERAYFIISNIV