EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03260 alignment
(6 sequences with 259 aa)


Q05432_BOMMO/6-261 FFSTCVLAASAGLIDLDINILSAPTR-AETRLVDAITTADYNTAVSLILLLEKQSSGSIIEDTVNNLIRDGNRNVLEFAYKLWIGEGKEIVKHYFPVQFRQVLSESNVKIINKRDNLAIKLGAAADSDNDRIAYGDANDKSSENVSWKLIPLWENNRVYFKIYSVRRHQYLKLG--TGTDGENDHSVYGDDRADTHRHQWYLKPAKLDNQVLFYIYNRQYNQALKLSRSVDSDGDRRAYSSSSSVEGQPELFGWSISIL
VITM_MANSE/1-249 MLRTTVVLLTLAAIAFAAP--------TSDDIYNNVVIGDIDGAVAKSKELQKQGKGDIITEAVNRLIRDSQRNTMEYAYQLWSLEARDIVKERFPIQFRMMLGEHSIKLINKRDNLAMKLGVATDNSGDRIAYGAADDKTSDRVAWKFVPLSEDKRVYFKILNVQRGQYLKLG--VETDSDGEHMAYASSGADTFRHQWYLQPAKADGNLVFFIVNREYNHALKLGRSVDSMGDRQVWGHNGNVIGNPELFGWSVVAF
L302_BOMMO/6-263 VFASCVLAVSAGVAEMSAVSMSSSNKELEEKLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDGSRNTMEYCYKLWVGNGQHIVRKYFPYNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANERLAYGDGKEKNSDLISWKFITLWENNRVYFKIHNTKYNQYLKLS-STTDCNTQDRVIFGTNTADTTREQWFLQPTKYENDVLFFIYNREYNDALKLGRIVDASGDRMAFGHDGEVAGLPDIFSWFVTPF
LP2_BOMMO/6-264 VFAMCVPAASAGVVELSADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTDLVSWKFITLWENNRVYFKAHNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTREQWFFQPAKYENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPDIYSWFITPF
LP3_BOMMO/6-254 VI-LCLFVASLYAADSDV--P---NDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVQGDDGRPAYG--KDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLG--VGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIYNREYSKALTLSRTVEPSGHRMAWGYNGRVIGSPEHYAWGIKAF
LP1_BOMMO/9-256 VLAVCALASNATLAPRTD-------DVLAEQLYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQLWTKDGKEIVKSYFPIQFRVIFTEQTVKLINKRDHHALKLIDQQN--HNKIAFGDSKDKTSKKVSWKFTPVLENNRVYFKIMSTEDKQYLKLD--NTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESDVMFFVYNREYNSVMTLDEDMAANEDREALGHSGEVSGYPQLFAWYIVPY