EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03233 alignment
(3 sequences with 170 aa)


VAT_FMVD/1-164 MSKDHLDFPHVYKKNKVLKLKPLDLSKNPRSYYFSSQNGSIQAIINHCNNINQITARNWLKLSKVLSYFGLEKDTSDSISKNKSPFNRFLKDISHIFREGEGSTKKASELGEILEKIKN---LDLKIENLN---KRIPDNLVTKALIKELVKDFDERLTEVRDDIKKVIG
VAT_CERV/1-166 MS--LTTYPHIYKKEQILKLKRLNKLSNDRKFFFSSVKGTLPGIISHCNNINEILGRCYLGICKLNSFFGLSKDPSDKLSVSKSPS--VYTLPSKIFKEGGGNGDNTTTQTDILKNAQDQVILSKKIDELQTQVKELSSKIEPEPLTKEDIKKTYETLSRIESGLKGIIG
VAT_CAMVC/1-159 MS--ITGQPHVYKKDTIIRLKPLSLNSNNRSYVFSSSKGNIQNIINHLNNLNEIVGRSLLGIWKINSYFGLSKDPSE--SKSKNPS--VFNTAKNIFKSRGVDYSSQLKEVKSLLEAQN-----TRIKNLENAIQSLDNKIEPEPLTKEEVKELKESINSIKEGLKNIIG