EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03201 alignment
(6 sequences with 100 aa)


HMDY_METJA/205-302 ADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQ--KDLDAALEILQNL
O26604_METTH/200-297 ADVTSAVADMGSLVTAVALAGVLDYYYVGTQIIKAPEEMVEKQILMTLQTMASLVETSGVDGMAAAINPELLVKSARSMHLLDEQ--EELDAALKKISDL
HMDX_METJA/194-291 ADVVPAVADMGALVTAVALVGVLDYYRVGTQIINAPKDMIEKQILISLQTIASIIETSGMEGLMKVFNKDALLSSAKNMLIDERQ--EDLNLALKIIEEF
HMD_METTL/243-340 ANLISPVCDMGSAVTAPVYAAVLAYRDAVTKILGAPADFAQMMADEAITQILELMRKEGINNMEKTLDPKALTGTADSMCFGPLS--DILPPALKVLEKH
HMD_METTH/245-342 AELLGPVCDMCSALTAITYAGILSYRDSVTQVLGAPAGFAQMMAKESLEQITALMEKVGIDKMEEHLDPGALLGTADSMNFGASA--DILPTVFEILEKR
HMD_METKA/253-352 GYLLGPVCDMASAVTAIVYAGLLTFRDACTDILGAPVDFTQNMAVEALQMMAKFMEEEGLDKLEEALDPAALTNTADSMNFGPLADTEILPKALEVLEKY