EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03197 alignment
(4 sequences with 104 aa)


Q37934_BPK3/27-126 SIVKAIRDNGGWFEVKEVSVAN-GYKAVKHIECANGKHFYLKDR---LLEICEDEFHCFREYKEPTSEKDEVKDPVSGVTKIHCIVDENNVDEIIELLRKTFKK
Q38547_9VIRU/27-121 SIVKIIQENGGWFEAKEAFFVD-GFRVIKHIECANGKHFYFN--------VCEDEFHCFREYKEPTSEDDGAEDTVSGVTKIHCIVDENNVDEIIELLRKTFKK
Y14D_BPT4/26-128 SMVGIIQENGGWFEVKSISSLD-GFDYVTEIICANGEIYNDDGMGDDYFELSEEEFYCFREYKEPTSEEDEVKDKVSGVTKIHCIVDENNVDEIIELLRKTFKK
Q37949_BPLZ5/1-103 MMLNLIEKHGPSFVVDEMESDDCAGECVVRVTMEDGTEYMAGGPLETYFPIYPEEFKYFTEVTLEKPQ-SANEGIVSGVTKIHCIVDENNVDEIIELLRKTFKA