EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03181 alignment
(13 sequences with 227 aa)


Q942D4_ORYSA/211-428 ALFFLEKDLHPGKTMAVHFT-.-ATTAGEKFLPRSEADAMPFSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGERKACATSLESMVDFATSSLG-TSHVRAASTVVGKEGSPEQEYTV--TAVKRAAAGGDqDQLVACHAEPYAYAVFACHLTRA.TRAYAVSMAGRDGT--GVEAVAVCHADTAGWNPKHVAFQVLKVKPGTVPVCHFLPQDHVVWTRS
RD22_ARATH/174-392 ALFFLEKDLVRGKEMNVRFNAeDGYGGKTAFLPRGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECEARKVSGEEKYCATSLESMVDFSVSKLG-KYHVRAVSTEVAKKNAPMQKYKIAAAGVKKLSD---.DKSVVCHKQKYPFAVFYCHKAMM.TTVYAVPLEGENGM--RAKAVAVCHKNTSAWNPNHLAFKVLKVKPGTVPVCHFLPETHVVWFSY
Q947D4_PRUPE/134-346 AIFFLEKDIRPGTSMTLTFS-.-GNSNTAAFVPRKTADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFSTSKLG--GNIQAISTEA-EKGATLQKYTI-TPGVKKLAA---.GKSVVCHKQTYPYAVFYCHATKT.TRAYVVPLKGADGL--EAKAVAVCHTDTSEWNPKHLAFQVLKVKPGTVPVCHFLPKDHIVWVPK
Q94IC6_9ROSI/82-292 TIFFLEKDLKPGKSMNLYFF-.-ESSNTATFLPRHVADSMPFSSNKLQEAFREFSVKPGSLEAETMEDTIKECENPRIEGEEKYCVTSLESIVDFSSSKLG--KDIQAISTEV-EKQTGRQKYTI--AVVKKMAG---.DKSVVCHKQNYPYAVFYCHTTQ-.SRAYLVQLKGADRS--ELKAVATCHTNTSAWNPKHMAFQVLAVKPGTVPVCHFLTQSHVVWAPK
Q8VWQ1_GOSHI/123-335 ALFFLEKDMHPGATMSLHFT-.-ENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMKNTIKECEQPAIEGEEKYCATSLESMIDYSISKLG--KVDQAVSTEV-EKQTPMQKYTI-AAGVQKMTD---.DKAVVCHKQNYAYAVFYCHKSET.TRAYMVPLEGADGT--KAKAVAVCHTDTSAWNPKHLAFQVLKVEPGTIPVCHFLPRDHIVWVPK
Q8RUD9_SOYBN/91-305 RLFFLEEDLRAGKIFNMKFV-.NNTKATVPLLPRQISKQIPFSEDKKKQVLAMLGVEANSSNAKIIAETIGLCQEPATEGERKHCATSLESMVDFVVSALG-K-NVGAFSTEK-ERETESGKFVVVKNGVRKLGD---.DKVIACHPMSYPYVVFGCHLVPR.SSGYLVRLKGEDGV--RVKAVVACHRDTSKWDHNHGAFKVLNLKPGNGTVCHVFTEGNLLWLPN
Q8GSG3_9FABA/190-402 SNFFSEERLRRGAKLDVLFR-.-KRNFSTPLLTREIAEHLPFSSEKINEILEILAVKPDSKDAKNVEETLNHCEKPALKGEEKQCATSVESMVDFVTSKLGNNARVTSTELEI---GSKFQKFIV-KDGVKILAE---.EKIIACHPMSYPYVVFYCHKMAN.STAHFLPLEGEDGT--RVKAVAICHKDTSQWDPHHVAFQVLKVKPGTSSACHFFPEGHLVWYAK
O65009_BRANA/58-282 YMFFKISDLKLGTKLPIYFNK.NDLRKVPPLLTRQEADLIPFSESNLDFLLNHFSISKDSPQGKAMKETLKRCDFKAIEGEYKFCGTSLESMLDLAKKTIASNADLKVMTTKVMVPDQNRISYALHNYTFAEVPKELDgIKVLGCHRMPYPYVVYYCHGHKSgTKVFEVNLMSDDGIQ-LVVGPAVCHMDTSMWNADHVAFKVLKIEPRSAPVCHFFPLDNIVWVSK
Q06765_SOYBN/70-259 KTFFYKEDLHPGKTMKVQFSKpPFQQPWGVGTWLKEIKD----TTKEGYSFEELCIKKE-----------------AIEGEEKFCAKSLGTVIGFAISKLG--KNIQVLSSSF---VNKQDQYTV--EGVQNLG----.DKAVMCHRLNFRTAVFYCHEVRE.TTAFMVPLVAGDGT--KTQALAICHSNTSGMNH-QMLHQLMGVDPGTNPVCHFLGSKAILWVPN
SVF30_VICFA/66-259 STLFFEHDLHPRKNFILGNTNsVGSIIRPFTKSRQGVTDSIWLANKEKQSLEDF------------------CYSPTAIAEHKHCVSSLKSMIDQVISHFG-STKIKAISSNF---APYQDQYVV--EDVKKVG----.DNAVMCHRLNFEKVVFNCHQVRD.TTAYVVSLVASDGT--KTKALTVCHHDTRGMNP-ELLYEALEVTLGTVPVCHFIGNKAAAWVPN
P93217_LYCES/412-628 GKFFREKMLKSGTIMPMPDI-.KDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMIGDALSECERAPSPGETKQCVNSAEDMIDFATSVLGRNVVVRTTENTN----GSKGNIMI--GSIKGINGGKV.TKSVSCHQTLYPSLLYYCHSVPK.VRVYEADILDPNSKAKINHGVAICHVDTSSWGPRHGAFIALGSGPGKIEVCHWIFENDMTWATA
O80760_ARATH/407-623 GKFFREAMLKEGTLMQMPDI-.KDKMPKRTFLPRNIVKNLPFSSSTIGEIWRVFGAGENSSMAGIISSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVV----GSKKKVVI--GKVNGINGGDV.TRAVSCHQSLYPYLLYYCHSVPR.VRVYETDLLDPKSLEKINHGVAICHIDTSAWSPSHGAFLALGSGPGQIEVCHWIFENDMTWNII
O64599_ARATH/409-625 GKFFRESSLKEGTVIPMPDI-.KDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVA----GSKEKVVI--GKVNGINGGKL.TKAVSCHQSLYPYLLYYCHSVPK.VRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNWAIA