EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03176 alignment
(37 sequences with 116 aa)


P96687_BACSU/117-220 TIAKDGTVAYADIQYKSS-----ADDIKDYSIKHLKDSLKMADDEGLQTE.LSG------DVPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIG
Q9Z577_STRCO/114-218 LISENADTAYATVTFEDA-----SQDLDPGQARAVVDTAEAAETGGLRIE.LGG-----GAIALTESGGSHLAEAVGVAVAAVVLFLAFGSVAAALLPIATALVSVGTAYAGITLL
Q9RL63_STRCO/118-220 TVSQDGSTAYATVTYEVT-----EDNVTDAGRADLTAAVERARTSGLTVE.AGG-------GAVAGEPPAGIGEFLGIGVAAVVLLITFGSLAAAGLPLITAVVGVALTLASIVAL
Q9RKC1_STRCO/118-220 AVSEDGTIAYASVKYDVS-----GMELEESTKDALEDAAQQARDAGLTVE.IGG-------DALQAVPETGATEVIGIAVAAVVLVITFGSLVSAGLPLLTALIGVGIGVSSITAL
MMPLB_STRCO/126-235 LVSQDRGAQLVIVPMEGSPSDESFQNAVDEVRALASD-----RAGPADVA.VTGPAGIATDTVKVFSGGDKVLLLATVVLVLIILLAIYRSPLMALVPLLAVGVAMRVAETLGAIL
MMPLD_STRCO/118-225 LPSDDGRALQAVVQVEPDLGERLP-DVLADIGDAAGQVP------GTRAQ.LAGPAASQADLSDAFAGIDGLLLAVALITVLVILLLVYRSVLLPLVIILSAVFALALSCAIVYAL
MMPLA_STRCO/111-222 VRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPS---APDGLGVH.VTGPTGYAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLL
MMPL7_MYCTU/150-261 GTSPDGRSATAMVWLRGEAGTTQAAESLDAVRSVLRQLP---PSEGLRAS.IVVPAITNDMPMQITAWQSATIVTVAAVIAVLLLLRARLSVRAAAIVLLTADLSLAVAWPLAAVV
Q9XB10_MYCBO/119-230 ARSDDHHAVTAALRFGGMVGTSQAGESITAARSIVTQLH---PPDGLHVF.VTGPGATIVDEFAAIDRQTQLITATTIVVLLILLLIVYRSAITATVPLLSVVVSLAVAKPIVSVL
Q9XCF5_MYCAV/131-242 AQSQDGKAAYVQVNLNGNAGAAAGDESVAAIRKLVQEAS---PPPGLKVY.VTGPAPIVADMNIAGQKTVMLVTLASLIVIFVTLLLVYRSVITVILLLLIVGLELQIARGMVALL
Q9XCF6_MYCAV/129-240 AQSPDGKAVYVQLNLAGNQGTTLGQESVAAVRDAIARIP---PPAGLKAY.VTGPAALFSDMQLAGDRSILKMTLIGALIIFIVLLFVYRSVTTVVLLLLTVGIEVFAARGVIAFV
MMPL5_MYCTU/139-250 AQSSDGKAAYVQVKLAGNQGESLANESVEAVKTIVERLA---PPPGVKVY.VTGSAALVADQQQAGDRSLQVIEAVTFTVIIVMLLLVYRSIITSAIMLTMVVLGLLATRGGVAFL
MMPL9_MYCTU/134-245 AVSADGKAAYVQLYLAGNMGEALANESVEAVRKIVANST---PPEGIRTY.VTGPAALFADQIAAGDRSMKLITGLTFAVITVLLLLVYRSIATTLLILPMVFIGLGATRGTIAFL
MMPL4_MYCTU/135-246 VQSNDGKAAYVQLSLAGNQGTPLANESVEAVRSIVESTP---APPGIKAY.VTGPSALAADMHHSGDRSMARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVL
MMPL4_MYCLE/132-243 AQSNDGKAAYVQLSLAGNQGELLAQESIDAVRKIVVQTP---APPGITAW.VTGASALIADMHHSGDKSMIRITATSVIVILVTLLLVYRSFITVILLLFTVGIESAVARGVVALL
MMPL2_MYCTU/130-240 SQSADDRAAYVVVYLVGN-NETEAYDSVHAVRHMVDTTP---PPHGVKAY.VTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLVLIMVGIDLGAIRGFIALL
MMPL1_MYCTU/128-239 SQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVDSVP---PPPGIKAY.VTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIMLLTVGLELLAVRGIISTF
Q50085_MYCLE/4-113 SQSSDNQAVYVQMYLASNQGKNLANES---VQQIVNGTP---ALSDIKAYmIGGAVPAGADQSTAGEHRVQQVTMITFLVDIVMLLFVYCSVVQVNLTLVMVVIELMVARQGIIFQ
MMPLC_MYCTU/132-243 LASKDNKAWNLPITFAGDAASPETQAAFKRVAAIVKQTV---AGTSLTVH.LSGPIATVADLTELGEKDVRIIEIGTAVSVLIILILVYRNLVTMLVPLATIGASVVTAQGTLSGL
MMPL8_MYCTU/150-260 MTSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQV---AGSTLTAN.LTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITMVLPLITIGMSVVVAQRLVA-I
MMPLA_MYCLE/131-245 LVSKDGKAWILPIVLAGELGTSASYQAYAGVAGIVKQTLESTAGSSLKAN.LTGPASTVADLTDAGARDRTSIELVIAVLLLTILMIIYRNPITMLLPLITIGASLMTAQAVVSGV
MMPLA_MYCTU/105-216 LGSKDGKAWILPIGLAGDLGTPKSYHAYTDVERIVKRTV---AGTTLTAN.VTGPAATVADLTDAGARDRASIELAIAVMLLVILMVIYRNPVTMLLPLVTIGASLMTAQALVAGV
YDGH_BACSU/112-216 LMSKDKKTVLMPVTITGS----------DKKAEKIADEIYQIVPDDLTAY.ITGASLINQDFAHSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGIL
MMPLA_STRCO/452-559 PQVKDGL-AYVEATLGAGADSPAAMRSVTAARETLA------RLDGAQAR.VGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALF
MMPLC_MYCTU/756-870 FLSADGHAARYFVQSALNPATTEAMDQVNDILRVADSARPNTELEDATIG.LAGVPTALRDIRDYYNSDMKFIVIATIVIVFLILVILLRALVAPIYLIGSVLISYLSALGIGTLV
MMPLA_MYCTU/735-849 FISPDGHTVRYFIQTDLNPFSTAAMDQVNTIIDTAKGAQPNTSLADASIS.MSGYPVMLRDIRDYYERDMRLIVAVTVVVVILILMALLRAIVAPLYLVGSVVISYMSAIGLGVVV
MMPLA_MYCLE/768-882 FISPDGHSVRYFIQTDLNPFSSAAMDQVNTILNVATGAQPNTTLSDASIY.LSGYTVTLRDTRDYYDRDLQLIVIVTMIVVLLILMALLRSIVAPIYLVGSVIVSYLSALGLCVLV
MMPL8_MYCTU/803-917 FISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNTALADAKVS.VVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLIGSVIVSYLAALGIGVIV
Q9XB10_MYCBO/698-812 FVSPNGHATRLLVYGDGSEWGDDGAQRARAIVTAVAEETDEGTLRPTAVE.LTGVGPATRDLQDLVGSDLTLLAVITLAVIFAIAALLLRSPLAGLVVVGTIATSYICALGASVVI
MMPL6_MYCTU/124-238 FLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIY.LAGTAATFKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLV
MMPL2_MYCTU/697-811 FLSPDGKAARFVIALEGDPATPEGISRVEPIKREAREAIKGTPLQGAAIY.LGGTAATFKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLV
Q9XCF6_MYCAV/697-811 FLSPDGKAARFIISHRGDPATSEALNRIDKIRSAAEEALKNTPLENAKIY.LAGTASTFKDFRDGSTYDLFIAGVGALCLIFIIMLILTRSFIAALIIVGTVTLSLGASFGLSVLI
Q9XCF5_MYCAV/701-815 FMSPDGKDVRLLISQRGDPATPEGLSRVEQIKTAAEEALKGTPLENSRIY.LTGTAAITKDLAQGSKFDLLIAGVSALCLIFIIMLIMTRSFIAAMVIVGTVLLSLGASFGLSVLV
MMPL5_MYCTU/708-822 FLSPDGHAVRFIISHEGDPMSQAGIARIAKIKTAAKEAIKGTPLEGSAIY.LGGTAAMFKDLSDGNTYDLMIAGISALCLIFIIMLITTRSVVAAAVIVGTVVLSLGASFGLSVLI
Q50086_MYCLE/127-241 FLSSDGHAARFIILHRGDPASVAGIASINAIRTAAEEALKGTPLEDTKIY.LAGTAAVFKDIDEGANWDLVIAGISSLCLIFIIMLIITRAFVAAAVIVGTVALSLGASFGLSVLL
MMPL1_MYCTU/696-810 FLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIY.LAGTSSTYKDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLI
MMPL9_MYCTU/702-816 FLSPNGKAVRFVISHESDPASTEGIDRIEAIRAATKDAIKATPLQGAKIY.IGGTAATYQDIRDGTKYDILIVGIAAVCLVFIVMLMITQSLIASLVIVGTVLLSLGTAFGLSVLI