EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03172 alignment
(4 sequences with 106 aa)


AIRE_HUMAN/1-106 MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDL
LY10_HUMAN/36-139 QVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEH-FQEAFRNLVPVTRVMYCVLSELEKTFGWSHLE-ALFSRINLMAYPDLNEIYRSFQNVCYE
SP10_HUMAN/47-150 RLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFED-SQDSCRNLVPVQRVVYNVLSELEKTFNLPVLE-ALFSDVNMQEYPDLIHIYKGFENVIHD
S100R_MOUSE/19-122 MHLIECMLKHFKIQKVAISNAIRSTFPFLESLRDREFITGKMYED-LLDSCRSLVPVDKVIYRALEELEKKFDMTVLC-KLFNEVNMEKYPDLNLLRRSFECGAKP